DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and Plat

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_037283.2 Gene:Plat / 25692 RGDID:3342 Length:559 Species:Rattus norvegicus


Alignment Length:361 Identity:88/361 - (24%)
Similarity:148/361 - (40%) Gaps:69/361 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 YPGPAGLSTSSSS--PFSSSGSLEHDAEMSASNVDNRHIKGLGMGREMSALSEEDDREPL--VLN 102
            |.|....:||.:|  |::|...:........:|     .:.||:||.....:.:.|.:|.  |:.
  Rat   221 YRGTHSFTTSKASCLPWNSMILIGKTYTAWRAN-----SQALGLGRHNYCRNPDGDAKPWCHVMK 280

  Fly   103 --------LETTPLMEKMLPEGAMAMDRIFGGDVGNPHCFPYQVGMLLQR---PKGLYWCGGSLI 156
                    .:.:|.....|.:......||.||...:....|:|..:.::.   |...:.|||.||
  Rat   281 DRKLTWEYCDMSPCSTCGLRQYKQPQFRIKGGLFTDITSHPWQAAIFVKNKRSPGERFLCGGVLI 345

  Fly   157 SDKHVITAAHCVDMAKRALVFLGANEIKNAKEKGQVRLMVPSENFQ--------IYPTWNPKRLK 213
            |...|::||||  ..:|    ...:.:|..  .|:...:||.|..|        ::..::.....
  Rat   346 SSCWVLSAAHC--FVER----FPPHHLKVV--LGRTYRVVPGEEEQTFEIEKYIVHKEFDDDTYD 402

  Fly   214 DDIAIVRL--------PHAVSFNERIHP---IQLPKRHYEYRSFKNKLAIASGWGRYATGVHAIS 267
            :|||:::|        ..:.|......|   :|||    ::...:     .||:|::.......|
  Rat   403 NDIALLQLRSDSSQCAQESSSVGTACLPDPDVQLP----DWTECE-----LSGYGKHEASSPFFS 458

  Fly   268 NVLRYVQLQIIDGRTCKSN--FPLSYRGTNIC-----TSG-RNARSTCNGDSGGPLVLQRRHSKK 324
            :.|:...:::.....|.|.  |..:.....:|     |.| ::....|.||||||||..  ..|:
  Rat   459 DRLKEAHVRLYPSSRCTSQHLFNKTITSNMLCAGDTRTGGNQDVHDACQGDSGGPLVCM--IDKR 521

  Fly   325 RVLVGITSFGSIYGC-DRGYPAAFTKVASYLDWISD 359
            ..|:||.|:|  .|| .:..|..:|||.:||:||.|
  Rat   522 MTLLGIISWG--LGCGQKDVPGIYTKVTNYLNWIQD 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 68/265 (26%)
Tryp_SPc 123..359 CDD:238113 69/266 (26%)
PlatNP_037283.2 Important for binding to annexin A2. /evidence=ECO:0000250 39..49
Kringle 124..205 CDD:395005
KR 210..295 CDD:238056 16/78 (21%)
Tryp_SPc 311..556 CDD:238113 69/266 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.