DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and Cma1

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_037224.1 Gene:Cma1 / 25627 RGDID:2365 Length:247 Species:Rattus norvegicus


Alignment Length:275 Identity:76/275 - (27%)
Similarity:123/275 - (44%) Gaps:51/275 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 LNLETTPLMEKMLPEGAMAMDRIFGGDVGNPHCFPYQVGM-LLQRPKGLYWCGGSLISDKHVITA 164
            :||....|:..:|.....| ..|.||....||..||...: ::.....|..|.|.||....|:||
  Rat     1 MNLHALCLLLLLLGSSTKA-GEIIGGTECIPHSRPYMAYLEIVTSDNYLSACSGFLIRRNFVLTA 64

  Fly   165 AHCVDMAKRAL-VFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVR-------- 220
            |||   |.|:: |.|||:. |..||....:|.|  |...|:|.::.:.:..||.:::        
  Rat    65 AHC---AGRSITVLLGAHN-KTYKEDTWQKLEV--EKQFIHPNYDKRLVLHDIMLLKLKEKAKLT 123

  Fly   221 -----LPHAVSFNERIHPIQLPKRHYEYRSFKNKLAIASGWGRYATGVH-AISNVLRYVQLQIID 279
                 ||.:.:|| .|.|              .::..|.||||  |.|: ..|:.|:.|::::.:
  Rat   124 LGVGTLPLSANFN-FIPP--------------GRMCRAVGWGR--TNVNEPASDTLQEVKMRLQE 171

  Fly   280 GRTCKSNFPLSYRGTNICTSG-RNARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGY 343
            .::|| :|......:.:|... :..::...|||||||:.      ..:..||.|:   ...:...
  Rat   172 PQSCK-HFTSFQHKSQLCVGNPKKMQNVYKGDSGGPLLC------AGIAQGIASY---VHPNAKP 226

  Fly   344 PAAFTKVASYLDWIS 358
            ||.||:::.|..||:
  Rat   227 PAVFTRISHYRPWIN 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 69/251 (27%)
Tryp_SPc 123..359 CDD:238113 71/253 (28%)
Cma1NP_037224.1 Tryp_SPc 21..240 CDD:214473 69/251 (27%)
Tryp_SPc 22..243 CDD:238113 71/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1076876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.