DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and Plau

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_037217.3 Gene:Plau / 25619 RGDID:3343 Length:432 Species:Rattus norvegicus


Alignment Length:331 Identity:80/331 - (24%)
Similarity:143/331 - (43%) Gaps:68/331 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 LGMGREMSALSEEDDREP---LVLNLETTPLMEKMLPEGAMAMD--------------------- 121
            ||:|:.....:.::.|.|   :.:.|       |...:..|..|                     
  Rat   114 LGLGKHNYCRNPDNQRRPWCYVQIGL-------KQFVQECMVQDCSLSKKPSSTVDQQGFQCGQK 171

  Fly   122 ------RIFGGDVGNPHCFPYQVGMLLQRPKG---LYWCGGSLISDKHVITAAHC-VDMAKRA-- 174
                  :|.||:.......|:...:.|:...|   .:.|||||||...|.:|.|| |:..|:.  
  Rat   172 ALRPRFKIVGGEFTVVENQPWFAAIYLKNKGGSPPSFKCGGSLISPCWVASATHCFVNQPKKEEY 236

  Fly   175 LVFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRL--KDDIAIVRL----PHAVSFNERIHP 233
            :|:||.:: :|:...|:::..|  |...::..::.:.|  .:|||::::    ......:..|..
  Rat   237 VVYLGQSK-RNSYNPGEMKFEV--EQLILHEDFSDETLAFHNDIALLKIRTSTGQCAQPSRTIQT 298

  Fly   234 IQLPKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTNI-- 296
            |.||.| :....|.:...| :|:|:.:...:.....|:...::||....||..   .|.|:.|  
  Rat   299 ICLPPR-FGDAPFGSDCEI-TGFGQESATDYFYPKDLKMSVVKIISHEQCKQP---HYYGSEINY 358

  Fly   297 ---CTSGRNARS-TCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGC-DRGYPAAFTKVASYLDW 356
               |.:....:: :|:|||||||:.  ....:..|.||.|:||  || ::..|..:|:|:.:|:|
  Rat   359 KMLCAADPEWKTDSCSGDSGGPLIC--NIDGRPTLSGIVSWGS--GCAEKNKPGVYTRVSYFLNW 419

  Fly   357 ISDETG 362
            |....|
  Rat   420 IQSHIG 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 68/253 (27%)
Tryp_SPc 123..359 CDD:238113 70/254 (28%)
PlauNP_037217.3 Binds urokinase plasminogen activator surface receptor 34..57
KR 67..152 CDD:238056 9/44 (20%)
Connecting peptide 152..178 0/25 (0%)
Tryp_SPc 178..420 CDD:214473 68/253 (27%)
Tryp_SPc 179..423 CDD:238113 70/255 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.