DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and CG30323

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:259 Identity:53/259 - (20%)
Similarity:89/259 - (34%) Gaps:84/259 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 YWCGGSLISDKHVITAAHCVDMAKRALVFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLK 213
            ::|.|||:|...|:|:..||.....:.    .|:..|.|   .:|::|          :.|||||
  Fly    52 HFCAGSLLSAWWVVTSGCCVSTRPEST----PNQPSNRK---NLRVVV----------FTPKRLK 99

  Fly   214 -----------------------DDIAIVRLPHAVSFNERIHPIQLPKRHYEYRSFKNKLAIASG 255
                                   .::|:::|...|: .:|. .:.||::........|.|    |
  Fly   100 KPSPKNIYHVQKIVLDESAISGCTELALLKLDRGVT-GQRF-AMMLPEKELNSTWLCNSL----G 158

  Fly   256 WGR--YATGVH----------------------AISNVLRYVQLQIIDGRTCKSNFPLSYRGTNI 296
            |||  |.:.|:                      ..|:.|..::.|.|....||.:.     ...:
  Fly   159 WGRIYYVSYVYISAMCPAFSMVYDNPVTWFQDGPYSSELIQIRAQKISEYECKPDC-----SRCL 218

  Fly   297 CTSGRNAR-STCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLDWISD 359
            |.:....| :.|..|.|.||...      ..|.|:..  .::.||......:|.:.....:|.|
  Fly   219 CMTSYTGRGNMCQQDLGSPLFCD------HFLYGVAR--RVHTCDDEGFMFYTNIYQNRKFIED 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 51/255 (20%)
Tryp_SPc 123..359 CDD:238113 52/257 (20%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 53/259 (20%)
Tryp_SPc 45..272 CDD:214473 51/255 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471267
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.