DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and CG30098

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:245 Identity:65/245 - (26%)
Similarity:112/245 - (45%) Gaps:34/245 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 RIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCVDMAKRALVFLGANEIKNA 186
            |:.||.  |....|:...::..   ..:.||||||:.:.|:|||||..:.....|.||..:....
  Fly    36 RVIGGQ--NARRTPWMAYLIRD---NRFACGGSLIAYRFVLTAAHCTKINDNLFVRLGEYDSSRT 95

  Fly   187 KEKGQVRLMVPSENFQIYPTWNPKRLKD----DIAIVRLPHAVSFNERIHPIQLPKRHYEYRSFK 247
            .: ||.|      ::::...:..|...|    |||:::|...|.::..|.||.: ..:...:|..
  Fly    96 TD-GQTR------SYRVVSIYRHKNYIDFRNHDIAVLKLDRQVVYDAYIRPICI-LLNSGLQSLA 152

  Fly   248 NKLA--IASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTNICTSGRNARSTCNGD 310
            |.:.  ..:|||:.| ..:.:...|:.:.|:.:....|      .....:|| .....:..|.||
  Fly   153 NSIQNFTLTGWGQMA-HYYKMPTTLQEMSLRRVRNEYC------GVPSLSIC-CWNPVQYACFGD 209

  Fly   311 SGGPLVLQRRHSKKRVLV--GITSFGSIYG-CDRGYPAAFTKVASYLDWI 357
            |||||....::..|.:.|  |:|:  |:.| || || :::..:.||:.|:
  Fly   210 SGGPLGSLVKYGHKTIYVQFGVTN--SVTGNCD-GY-SSYLDLMSYMPWL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 64/243 (26%)
Tryp_SPc 123..359 CDD:238113 64/244 (26%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 64/242 (26%)
Tryp_SPc 37..258 CDD:238113 64/244 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436447
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.