DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and CG30091

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:292 Identity:78/292 - (26%)
Similarity:132/292 - (45%) Gaps:46/292 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 LGMGREMSALSEEDDREPLVLNLETTPLMEKMLPEGAMAMDRIFGGDVGNPHCFPYQVGMLLQRP 145
            |..||..:.|.:||...|:           :::|:....:|   .|::.||       .|.|.:.
  Fly    13 LTAGRGSARLLDEDCGVPM-----------QLIPKIVGGVD---AGELKNP-------WMALIKT 56

  Fly   146 KGLYWCGGSLISDKHVITAAHCVDMAKRAL-------VFLGANEIKNAKEKGQVRLMVPSENFQI 203
            ...:.||||:|::|.|:|||||:...:..:       |.||...:....|......:...|...|
  Fly    57 NDEFICGGSVITNKFVLTAAHCMCTDEECIVKYTQLTVTLGVYHLLATGEHNHPHEIYNVERVYI 121

  Fly   204 YPTWNPKRLKDDIAIVRLPHAVSFNERIHPI------QLPKRHYEYRSFKNKLAIASGWGRYATG 262
            :.::..:..::|||::||..::.:..:|.|:      ||..:....:.|     .|.|||  .||
  Fly   122 HDSFAIQNYRNDIALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLIQEF-----TAIGWG--VTG 179

  Fly   263 VHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTNICTSGRNARSTCNGDSGGPLVLQRRHS--KKR 325
            ...:||.|:.|::..||.:.|::.|..::.....|......|.||..||||||.:.....  |:.
  Fly   180 NGKMSNNLQMVKIYRIDRKMCEAAFWYTFDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRA 244

  Fly   326 VLVGITSFGSIYGCDRGYPAAFTKVASYLDWI 357
            ..:||.|.|: ..| ||: ..:|.|..::|:|
  Fly   245 TQLGIVSTGT-EDC-RGF-GMYTDVMGHIDFI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 68/249 (27%)
Tryp_SPc 123..359 CDD:238113 69/250 (28%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 69/256 (27%)
Tryp_SPc 37..276 CDD:238113 70/257 (27%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436440
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.