DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and Cela2a

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_036685.1 Gene:Cela2a / 24332 RGDID:2548 Length:271 Species:Rattus norvegicus


Alignment Length:279 Identity:89/279 - (31%)
Similarity:143/279 - (51%) Gaps:46/279 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 LMEKMLPEGAMA-----------MDRIFGGDVGNPHCFPYQVGM-LLQRPKGLYWCGGSLISDKH 160
            |:...|..||::           :.|:.||...:|:.:|:||.: .|...|..:.|||||:::..
  Rat     5 LLLSALVAGALSCGYPTYEVQHDVSRVVGGQEASPNSWPWQVSLQYLSSGKWHHTCGGSLVANNW 69

  Fly   161 VITAAHCVDMAKRALVFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLK--DDIAIVRLPH 223
            |:|||||:..::...|.||.:.: :..|.|.:.:.|  ....::..||.::|.  :|||:|:|..
  Rat    70 VLTAAHCISNSRTYRVLLGRHSL-STSESGSLAVQV--SKLVVHEKWNAQKLSNGNDIALVKLAS 131

  Fly   224 AVSFNERIHPIQLP------KRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRT 282
            .|:...:|....||      ..:|.        ...:||||..|. .|..:||:..:|.::|..|
  Rat   132 PVALTSKIQTACLPPAGTILPNNYP--------CYVTGWGRLQTN-GATPDVLQQGRLLVVDYAT 187

  Fly   283 CKSNFPLSYRGTN-----ICTSGRNARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRG 342
            |.|   .|:.|::     :|..|....|:|||||||||..|..:.:.:| .||.||||..||:  
  Rat   188 CSS---ASWWGSSVKTNMVCAGGDGVTSSCNGDSGGPLNCQASNGQWQV-HGIVSFGSTLGCN-- 246

  Fly   343 Y---PAAFTKVASYLDWIS 358
            |   |:.||:|::|:|||:
  Rat   247 YPRKPSVFTRVSNYIDWIN 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 83/251 (33%)
Tryp_SPc 123..359 CDD:238113 84/253 (33%)
Cela2aNP_036685.1 Tryp_SPc 30..264 CDD:214473 83/251 (33%)
Tryp_SPc 31..267 CDD:238113 84/253 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.