DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and Cela3a

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001119790.1 Gene:Cela3a / 242711 MGIID:3651647 Length:283 Species:Mus musculus


Alignment Length:264 Identity:73/264 - (27%)
Similarity:118/264 - (44%) Gaps:38/264 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 RIFGGDVGNPHCFPYQVGMLLQRPKG---LYWCGGSLISDKHVITAAHCVDMAKRALVFLGANEI 183
            |:..|:...||.:|:||.  ||...|   .:.||||||:...|:||.||:.......|.||.:| 
Mouse    27 RVVNGEEAVPHSWPWQVS--LQYEMGGSFHHTCGGSLITPDWVLTAGHCIMPYLNYRVVLGEHE- 88

  Fly   184 KNAKEKGQVRLM-VPSENFQIYPTWNPKRLK--DDIAIVRLPHAVSFNERIHPIQLPKRHYEYRS 245
             :..|:|..::: :.:....::|.||.:.:.  ::||:|:|..:....:.:....||...   ..
Mouse    89 -HGVEEGSEQVIPINAGELFVHPKWNSECVNCGNNIALVKLSRSAQLGDAVQLACLPPAG---EI 149

  Fly   246 FKNKL-AIASGWGRYATGVHAISNVLRYVQLQIIDGRTCK-----SNFPLSYRGTNICTSG---- 300
            ..|.. ...|||||.:|. ..:...|:...|.::|...|.     .::   .:.|.:|..|    
Mouse   150 LPNGAPCYISGWGRLSTN-GPLPTKLQQALLPVVDYEHCSRWDWWGHY---VKRTMVCAGGYIQA 210

  Fly   301 ---------RNARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDR-GYPAAFTKVASYLD 355
                     ....|...|||||||.....:...:| .||.||.|..||:. ..|..||:|::::|
Mouse   211 HSLSSDTHQPRLLSPLQGDSGGPLNCPADNGTWQV-HGIASFVSPSGCNTLKKPTMFTRVSAFID 274

  Fly   356 WISD 359
            ||.:
Mouse   275 WIEE 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 71/260 (27%)
Tryp_SPc 123..359 CDD:238113 72/261 (28%)
Cela3aNP_001119790.1 Tryp_SPc 27..276 CDD:214473 71/260 (27%)
Tryp_SPc 28..279 CDD:238113 72/263 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.