DRSC - DRSC Integrative Ortholog Prediction Tool

Protein Alignment CG6592 and Prss42

Sequence 1:	NP_648016.1	Gene:	CG6592 / 38687	FlyBaseID:	FBgn0035669	Length:	438	Species:	Drosophila melanogaster
Sequence 2:	NP_694739.1	Gene:	Prss42 / 235628	MGIID:	2665280	Length:	335	Species:	Mus musculus

Alignment Length:	33	Identity:	7/33 - (21%)
Similarity:	12/33 - (36%)	Gaps:	16/33 - (48%)

- Green bases have known domain annotations that are detailed below.

  Fly   144 GRYSDFAKQLNVNGFKVYGIDWIGHGGSDGLHA 176
            |.|:|:.:.                |.|||:.:
Mouse    61 GEYADYMRM----------------GMSDGIRS 77

Gene	Sequence	Domain	Region	External ID	Identity
CG6592	NP_648016.1	Tryp_SPc	123..359	CDD:238113	7/33 (21%)
Prss42	NP_694739.1	Tryp_SPc	79..310	CDD:238113
Blue background indicates that the domain is not in the aligned region.