DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and Prss3

DIOPT Version :10

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_035775.1 Gene:Prss3 / 22073 MGIID:102758 Length:246 Species:Mus musculus


Alignment Length:44 Identity:8/44 - (18%)
Similarity:22/44 - (50%) Gaps:7/44 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MICSSKGTVVIATRSSFPRLLNR----IQNRND---VPISVIAT 37
            :.|.:..|:.:...:.:.::|.:    ||.:|:   .|:.::.|
Mouse    96 LACLTAYTIFLCMETHYEKVLKKIAKFIQEQNEKIYAPLGLLLT 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 123..359 CDD:238113
Prss3NP_035775.1 Tryp_SPc 24..242 CDD:238113 8/44 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.