DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and Prss2

DIOPT Version :10

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_033456.1 Gene:Prss2 / 22072 MGIID:102759 Length:246 Species:Mus musculus


Alignment Length:39 Identity:13/39 - (33%)
Similarity:16/39 - (41%) Gaps:15/39 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   341 YNE-ASSSDKSIKLYDGLLHDLLFEPERETIAGVILDWL 378
            :|| |..|:....||          |.||    :.||||
Mouse   254 FNEFAGMSEPDYNLY----------PSRE----MQLDWL 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 123..359 CDD:238113 6/18 (33%)
Prss2NP_033456.1 Tryp_SPc 24..242 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.