powered by:
Protein Alignment CG6592 and Prss2
DIOPT Version :10
| Alignment Length: | 39 |
Identity: | 13/39 - (33%) |
| Similarity: | 16/39 - (41%) |
Gaps: | 15/39 - (38%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 341 YNE-ASSSDKSIKLYDGLLHDLLFEPERETIAGVILDWL 378
:|| |..|:....|| |.|| :.||||
Mouse 254 FNEFAGMSEPDYNLY----------PSRE----MQLDWL 278
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG6592 | NP_648016.1 |
Tryp_SPc |
123..359 |
CDD:238113 |
6/18 (33%) |
| Prss2 | NP_033456.1 |
Tryp_SPc |
24..242 |
CDD:238113 |
|
|
Blue background indicates that the domain is not in
the aligned region.
|
Return to query results.
Submit another query.