DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and F10

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_000495.1 Gene:F10 / 2159 HGNCID:3528 Length:488 Species:Homo sapiens


Alignment Length:259 Identity:81/259 - (31%)
Similarity:133/259 - (51%) Gaps:36/259 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 PE-GAMAMDRIFGG-DVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCVDMAKRALV 176
            || |...:.||.|| :..:..| |:|..::.:..:|  :|||:::|:.:::|||||:..|||..|
Human   225 PERGDNNLTRIVGGQECKDGEC-PWQALLINEENEG--FCGGTILSEFYILTAAHCLYQAKRFKV 286

  Fly   177 FLGANEIKNAKEKG-----QVRLMVPSENFQIYPTWNPKRLKD-DIAIVRLPHAVSFNERIHPIQ 235
            .:|  :....:|:|     :|.:::....|       .|...| |||::||...::|...:.|..
Human   287 RVG--DRNTEQEEGGEAVHEVEVVIKHNRF-------TKETYDFDIAVLRLKTPITFRMNVAPAC 342

  Fly   236 LPKRHY-EYRSFKNKLAIASGWGR-YATGVHAISNVLRYVQLQIIDGRTCK--SNFPLSYRGTNI 296
            ||:|.: |......|..|.||:|| :..|..  |..|:.:::..:|..:||  |:|.::   .|:
Human   343 LPERDWAESTLMTQKTGIVSGFGRTHEKGRQ--STRLKMLEVPYVDRNSCKLSSSFIIT---QNM 402

  Fly   297 CTSGRNAR--STCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDR-GYPAAFTKVASYLDWI 357
            ..:|.:.:  ..|.||||||.|  .|......:.||.|:|.  ||.| |....:|||.::|.||
Human   403 FCAGYDTKQEDACQGDSGGPHV--TRFKDTYFVTGIVSWGE--GCARKGKYGIYTKVTAFLKWI 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 76/248 (31%)
Tryp_SPc 123..359 CDD:238113 77/249 (31%)
F10NP_000495.1 GLA 25..85 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 129..164 CDD:317114
O-glycosylated at one site 183..203
Tryp_SPc 235..464 CDD:238113 77/249 (31%)
O-glycosylated at one site 476..485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.