DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and F2

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_000497.1 Gene:F2 / 2147 HGNCID:3535 Length:622 Species:Homo sapiens


Alignment Length:308 Identity:86/308 - (27%)
Similarity:136/308 - (44%) Gaps:60/308 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 EMSALSEEDDREPLVLNLETTPLMEKMLPEGAMAMDRIFGGDVGNPHCFPYQVGMLLQRPKGLYW 150
            |..:|.::.:||          |:|..: :|     ||..|........|:||.:..:.|:.|. 
Human   343 EKKSLEDKTERE----------LLESYI-DG-----RIVEGSDAEIGMSPWQVMLFRKSPQELL- 390

  Fly   151 CGGSLISDKHVITAAHCV------------DMAKRALVFLGANEIKNAKEKGQVRLMVPSENFQI 203
            ||.|||||:.|:|||||:            |:    ||.:|.:  ...:.:..:..:...|...|
Human   391 CGASLISDRWVLTAAHCLLYPPWDKNFTENDL----LVRIGKH--SRTRYERNIEKISMLEKIYI 449

  Fly   204 YPTWN-PKRLKDDIAIVRLPHAVSFNERIHPIQLPKRHYE----YRSFKNKLAIASGWGRY---- 259
            :|.:| .:.|..|||:::|...|:|::.|||:.||.|...    ...:|.::   :|||..    
Human   450 HPRYNWRENLDRDIALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRV---TGWGNLKETW 511

  Fly   260 -ATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTNICT-----SGRNARSTCNGDSGGPLVLQ 318
             |.......:||:.|.|.|::...||.:..:.......|.     .|:.. ..|.||||||.|::
Human   512 TANVGKGQPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRG-DACEGDSGGPFVMK 575

  Fly   319 RRHSKKRVLVGITSFGSIYGCDR-GYPAAFTKVASYLDWIS---DETG 362
            ...:.:...:||.|:|.  |||| |....:|.|.....||.   |:.|
Human   576 SPFNNRWYQMGIVSWGE--GCDRDGKYGFYTHVFRLKKWIQKVIDQFG 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 75/262 (29%)
Tryp_SPc 123..359 CDD:238113 76/266 (29%)
F2NP_000497.1 GLA 25..88 CDD:214503
KR 105..186 CDD:238056
KR 211..293 CDD:214527
Thrombin_light 317..363 CDD:286482 7/35 (20%)
Tryp_SPc 363..613 CDD:214473 75/262 (29%)
Tryp_SPc 364..616 CDD:238113 76/264 (29%)
High affinity receptor-binding region which is also known as the TP508 peptide 551..573 8/22 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.