DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and Prss27

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_780649.1 Gene:Prss27 / 213171 MGIID:2450123 Length:328 Species:Mus musculus


Alignment Length:338 Identity:94/338 - (27%)
Similarity:149/338 - (44%) Gaps:50/338 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 REPLVLNLETTPLMEKMLPEGAMAM---------DRIFGGDVGNPHCFPYQVGMLLQRPKGLYWC 151
            |:|.:..|...||:.:...|||..:         :|:.||:......:|:||.  :|| .|:::|
Mouse     2 RQPHIAALLLLPLLLRSGTEGARTLRACGHPKMFNRMVGGENALEGEWPWQVS--IQR-NGIHFC 63

  Fly   152 GGSLISDKHVITAAHCVDMAKRALVF---LGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLK 213
            |||||:...|:|||||........::   |||.::   ::.|...|.||.:..:..|.:......
Mouse    64 GGSLIAPTWVLTAAHCFSNTSDISIYQVLLGALKL---QQPGPHALYVPVKQVKSNPQYQGMASS 125

  Fly   214 DDIAIVRLPHAVSFNERIHPIQLPKRHYEYRSFKNKLAIASGWGRYATGVHAISN--VLRYVQLQ 276
            .|:|:|.|...|:|...|.|:.||.....:.|..|  ...:|||. .:....:.|  ||:.:.:.
Mouse   126 ADVALVELQGPVTFTNYILPVCLPDPSVIFESGMN--CWVTGWGS-PSEQDRLPNPRVLQKLAVP 187

  Fly   277 IIDGRTC--------KSNFPL-SYRGTNICTS-GRNARSTCNGDSGGPLVLQRRHSKKRVLVGIT 331
            |||...|        :|:|.| :.:...:|.. ....:..|.||||||||.....|  .|..|:.
Mouse   188 IIDTPKCNLLYNKDVESDFQLKTIKDDMLCAGFAEGKKDACKGDSGGPLVCLVDQS--WVQAGVI 250

  Fly   332 SFGSIYGC-DRGYPAAFTKVASYLDWISDETGVSAHQDTTEAIFFDQYVREYGKPRQSRRLETEE 395
            |:|.  || .|..|..:.:|.|:..||        ||...|.    |:....|..:|.:..:.::
Mouse   251 SWGE--GCARRNRPGVYIRVTSHHKWI--------HQIIPEL----QFQGRAGTQQQQKDSQGQQ 301

  Fly   396 QLEDDVPDELDVH 408
            :|..:....|..|
Mouse   302 RLAGNSAPCLAAH 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 75/250 (30%)
Tryp_SPc 123..359 CDD:238113 76/251 (30%)
Prss27NP_780649.1 Tryp_SPc 37..275 CDD:214473 75/250 (30%)
Tryp_SPc 39..278 CDD:238113 77/259 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.