DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and Plg

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_032903.3 Gene:Plg / 18815 MGIID:97620 Length:812 Species:Mus musculus


Alignment Length:251 Identity:80/251 - (31%)
Similarity:128/251 - (50%) Gaps:35/251 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 RIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCVDMAKRA---LVFLGANE- 182
            |:.||.|.|||.:|:|:. |..|..|.::|||:||:.:.|:|||||::.:.|.   .|.|||:| 
Mouse   581 RVVGGCVANPHSWPWQIS-LRTRFTGQHFCGGTLIAPEWVLTAAHCLEKSSRPEFYKVILGAHEE 644

  Fly   183 -IK--NAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQLPKRHYEYR 244
             |:  :.:|....:|::...|             .|||:::|....:..:::.|..||..:|...
Mouse   645 YIRGLDVQEISVAKLILEPNN-------------RDIALLKLSRPATITDKVIPACLPSPNYMVA 696

  Fly   245 SFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYR--GTNICTSGRNAR--S 305
            .  ..:...:|||. ..|...... |:..||.:|:.:.|.....|:.|  .|.:| :|:.|.  .
Mouse   697 D--RTICYITGWGE-TQGTFGAGR-LKEAQLPVIENKVCNRVEYLNNRVKSTELC-AGQLAGGVD 756

  Fly   306 TCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDR-GYPAAFTKVASYLDWISDE 360
            :|.||||||||...:  .|.:|.|:||:|  .||.| ..|..:.:|:.::|||..|
Mouse   757 SCQGDSGGPLVCFEK--DKYILQGVTSWG--LGCARPNKPGVYVRVSRFVDWIERE 808

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 77/246 (31%)
Tryp_SPc 123..359 CDD:238113 78/247 (32%)
PlgNP_032903.3 PAN_AP_HGF <38..97 CDD:238532
KR 101..183 CDD:214527
KR 183..262 CDD:214527
KR 273..354 CDD:214527
KR 375..456 CDD:214527
KR 480..562 CDD:214527
Tryp_SPc 581..805 CDD:214473 77/246 (31%)
Tryp_SPc 582..807 CDD:238113 78/247 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.