DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and Plat

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_032898.2 Gene:Plat / 18791 MGIID:97610 Length:559 Species:Mus musculus


Alignment Length:354 Identity:90/354 - (25%)
Similarity:144/354 - (40%) Gaps:55/354 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 YPGPAGLSTSSSS--PFSSSGSLEHDAEMSASNVDNRHIKGLGMGREMSALSEEDDREPL--VLN 102
            |.|...|:||.:|  |::|...:........:|     .:.||:||.....:.:.|..|.  |:.
Mouse   221 YRGTHSLTTSQASCLPWNSIVLMGKSYTAWRTN-----SQALGLGRHNYCRNPDGDARPWCHVMK 280

  Fly   103 --------LETTPLMEKMLPEGAMAMDRIFGGDVGNPHCFPYQVGMLLQR---PKGLYWCGGSLI 156
                    .:.:|.....|.:......||.||...:....|:|..:.::.   |...:.|||.||
Mouse   281 DRKLTWEYCDMSPCSTCGLRQYKRPQFRIKGGLYTDITSHPWQAAIFVKNKRSPGERFLCGGVLI 345

  Fly   157 SDKHVITAAHCVDMAKRALVFLGANEIKNAKEKGQVRLMVPSENFQ--------IYPTWNPKRLK 213
            |...|::||||.      |.....|.:|..  .|:...:||.|..|        ::..::.....
Mouse   346 SSCWVLSAAHCF------LERFPPNHLKVV--LGRTYRVVPGEEEQTFEIEKYIVHEEFDDDTYD 402

  Fly   214 DDIAIVRL----PHAVSFNERIHPIQLPKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQ 274
            :|||:::|    ......:..:....||..:.:...:..  ...||:|::.......|:.|:...
Mouse   403 NDIALLQLRSQSKQCAQESSSVGTACLPDPNLQLPDWTE--CELSGYGKHEASSPFFSDRLKEAH 465

  Fly   275 LQIIDGRTCKSNFPLSYRGTN--ICT----SGRN--ARSTCNGDSGGPLVLQRRHSKKRVLVGIT 331
            :::.....|.|....:...||  :|.    ||.|  ....|.||||||||..  .:|:..|.||.
Mouse   466 VRLYPSSRCTSQHLFNKTVTNNMLCAGDTRSGGNQDLHDACQGDSGGPLVCM--INKQMTLTGII 528

  Fly   332 SFGSIYGC-DRGYPAAFTKVASYLDWISD 359
            |:|  .|| .:..|..:|||.:|||||.|
Mouse   529 SWG--LGCGQKDVPGVYTKVTNYLDWIHD 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 69/258 (27%)
Tryp_SPc 123..359 CDD:238113 70/259 (27%)
PlatNP_032898.2 FN1 38..80 CDD:214494
Important for binding to annexin A2. /evidence=ECO:0000250 39..49
EGF 83..115 CDD:394967
Kringle 124..205 CDD:395005
KR 210..295 CDD:238056 17/78 (22%)
Tryp_SPc 311..556 CDD:238113 70/259 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.