DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and try-5

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_505421.3 Gene:try-5 / 187088 WormBaseID:WBGene00006623 Length:327 Species:Caenorhabditis elegans


Alignment Length:278 Identity:70/278 - (25%)
Similarity:110/278 - (39%) Gaps:76/278 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 MLPEGAMAMDRIFGGDVGNP-HCFPYQVGMLLQRPKGLY--WCGGSLISDKHVITAAHCV----- 168
            ||.:.|        |:.||| |..|:.|.:.::..||.:  .|||:||:.|||:|||||.     
 Worm    39 MLTDAA--------GNTGNPTHLAPWAVQIRVKARKGDFEVICGGTLITLKHVLTAAHCFQKHFG 95

  Fly   169 -------------------------DMAKRALVFLGA------------NEIKNAKEKGQVRLMV 196
                                     ::..|.:|.:||            ||.:|.|.....|..:
 Worm    96 AKKEGGEENSMSGRYCESNQRFTDSEILTRTVVTVGAMCTRLEQKYGCVNEKQNGKTLKISRFAI 160

  Fly   197 PSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQLPKRHYEYRSFKNKLAIAS------- 254
            .    ..|.|...:  .:||.|:.|...:...|..:...||        |..::.|.|       
 Worm   161 G----DFYKTHCEQ--GNDIVILELESTIDDVEGANYACLP--------FLPEVNIQSGANVTSF 211

  Fly   255 GWGR-YATGV-HAISNVLRYVQLQIIDGRTCKSNFPLSYRGTNICTSGRNARSTCNGDSGGPLVL 317
            |||. ...|. :|...:::.:.|......||:.|:..|....:.||:....::.|:|||||.|..
 Worm   212 GWGSDPGKGFDNAAFPMIQVLTLATETLATCEENWGTSIPFDSFCTAEEEDKNVCSGDSGGGLTF 276

  Fly   318 QRRHSKKRVLVGITSFGS 335
            .:..|.:..::.|.|:||
 Worm   277 HQSDSAREFIIAIVSYGS 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 67/268 (25%)
Tryp_SPc 123..359 CDD:238113 67/267 (25%)
try-5NP_505421.3 Tryp_SPc 48..296 CDD:389826 66/261 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.