DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and try-4

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_508030.4 Gene:try-4 / 185148 WormBaseID:WBGene00006622 Length:324 Species:Caenorhabditis elegans


Alignment Length:297 Identity:80/297 - (26%)
Similarity:116/297 - (39%) Gaps:99/297 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 FPYQVGMLLQRPKGLYWCGGSLISDKHVITAAH------------CVD--------MAKRALVFL 178
            ||:.|...:.   |:...|||:||..|:|||||            |.:        ...|::.||
 Worm    58 FPWAVSFTVD---GVNRLGGSIISPYHIITAAHGFITTIGSRGNLCENKNWKKPNSSIYRSIKFL 119

  Fly   179 --------GANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDI------------------- 216
                    |...|:...:|              ||. :|:..|.|:                   
 Worm   120 RDTRKVAYGGTCIRGHTDK--------------YPN-DPRCKKSDVIHNKVRAVLVDGEFASSNC 169

  Fly   217 ------AIVRLPHAVSFNERIHPIQLPKRHYEYRSFKNKLAIASGWGRYATGVHAISN----VLR 271
                  |||.:...:.|:|.:.||.||:.:..|    .|.....||||     ..|.|    ::.
 Worm   170 LKGHDWAIVEVEKRIHFSENVRPICLPRPNMYY----TKSLAVPGWGR-----SYIFNESGPLIH 225

  Fly   272 YVQLQIIDGRTCKSNFPLSYR----------GTNICTSGRNARSTCNGDSGGPLVLQRRHSKKRV 326
            .:.::|  .|.||.  |.|.|          .|::..|..:|..||:|||||.|..:..:..:..
 Worm   226 EIPMRI--DRDCKR--PWSDRLPADADDFICATSMNVSNYSAPRTCHGDSGGGLEYRDDNYGRAF 286

  Fly   327 LVGITSFGSIYGCDRGYPAAFTKVASYLDWISDETGV 363
            |:.|||||: .||.....|.||:|..||:.|.:.|||
 Worm   287 LIAITSFGT-RGCPSNMLARFTRVDMYLNLICNYTGV 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 76/289 (26%)
Tryp_SPc 123..359 CDD:238113 77/291 (26%)
try-4NP_508030.4 Tryp_SPc 51..318 CDD:238113 77/291 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.