DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and try-10

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001256475.1 Gene:try-10 / 179787 WormBaseID:WBGene00008849 Length:355 Species:Caenorhabditis elegans


Alignment Length:266 Identity:66/266 - (24%)
Similarity:109/266 - (40%) Gaps:63/266 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 CGGSLISDKHVITAAHCV----DMAKRALVFLG---ANEIKNAKEKGQVRLMVPSENFQIYPTWN 208
            |||.||:...|||:||||    |.|..|.|.||   .|:..:.:::.:...|..|:.|     :|
 Worm   104 CGGVLIAPSIVITSAHCVFSGDDFAVTAKVTLGDVHLNKHDDGEQEFRSHAMAISKKF-----FN 163

  Fly   209 -PKRLKDDIAIVRLPH--------------------AVSFNERIHPIQLPKRHYEYRSFKNKLAI 252
             .....||:|::.||.                    :|:|.|.....||        ..:..:..
 Worm   164 DASEANDDVAVIFLPQRADVCHSPLSLQIAKLPSTGSVNFKETAPLTQL--------QLETSVCY 220

  Fly   253 ASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTNICTSGRNARSTCNGDSGGPLVL 317
            .:|||:........|:.:|.:.:.:...|..|..:.::...|.   |.|    .|.||||.|:..
 Worm   221 VAGWGKTENKTAKYSDSVRQMMVNLSVRRIGKRKYLIAKAVTG---SSR----ACMGDSGSPVYC 278

  Fly   318 QRRHSKKRVLVG----ITSFGSIYGCDRGYPAAFTKVASYLDWISDETGVSAHQDTTEAIFFDQY 378
              ..:.||:|||    |.||..:...|.....:|.:...|       |.||..::::|.:.  :.
 Worm   279 --FVNGKRILVGTVAHIGSFSKMSEQDPSNHISFCRDFEY-------TFVSDWRESSERVV--EI 332

  Fly   379 VREYGK 384
            :::||:
 Worm   333 LQKYGE 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 60/237 (25%)
Tryp_SPc 123..359 CDD:238113 60/239 (25%)
try-10NP_001256475.1 Tryp_SPc 75..290 CDD:389826 54/207 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.