DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and Tpsb2

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:290 Identity:76/290 - (26%)
Similarity:127/290 - (43%) Gaps:57/290 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 LVLNLETTPLMEKML---PEGAMAMDRIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKH 160
            |:|.|....|:..::   |..|.....|.||...:...:|:||.:..:....:::||||||..:.
Mouse     5 LLLLLWALSLLASLVYSAPRPANQRVGIVGGHEASESKWPWQVSLRFKLNYWIHFCGGSLIHPQW 69

  Fly   161 VITAAHCVDMAKRALVFLGANEIKNAK-EKGQVR--------LMVPSENFQIYPTWNPKRLKDDI 216
            |:||||||           ...||:.: .:.|:|        .::......::|.:.......|:
Mouse    70 VLTAAHCV-----------GPHIKSPQLFRVQLREQYLYYGDQLLSLNRIVVHPHYYTAEGGADV 123

  Fly   217 AIVRLPHAVSFNERIHPIQLPKRHYEYRSFKNKLAIASGWGRYATGVHAISN--------VLRYV 273
            |::.|...|:.:..:|||.||.....:         ..|...:.||...|.|        .|:.|
Mouse   124 ALLELEVPVNVSTHLHPISLPPASETF---------PPGTSCWVTGWGDIDNDEPLPPPYPLKQV 179

  Fly   274 QLQIIDGRTCK----------SNFPLSYRGTNICTSGRNARSTCNGDSGGPLVLQRRHSKKRVLV 328
            ::.|::...|.          .:||:.:.|. :| :|...|.:|.||||||||.:.:.:  .:..
Mouse   180 KVPIVENSLCDRKYHTGLYTGDDFPIVHDGM-LC-AGNTRRDSCQGDSGGPLVCKVKGT--WLQA 240

  Fly   329 GITSFGSIYGCDR-GYPAAFTKVASYLDWI 357
            |:.|:|.  ||.: ..|..:|:|..|||||
Mouse   241 GVVSWGE--GCAQPNKPGIYTRVTYYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 68/262 (26%)
Tryp_SPc 123..359 CDD:238113 70/263 (27%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 70/263 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.