DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and TMPRSS6

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001275929.1 Gene:TMPRSS6 / 164656 HGNCID:16517 Length:824 Species:Homo sapiens


Alignment Length:266 Identity:80/266 - (30%)
Similarity:120/266 - (45%) Gaps:43/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 RIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCV---DMAKRAL--VFLGAN 181
            ||.||.|.:...:|:|..:   :.:|.:.|||:||:|:.|||||||.   .||...|  |||| .
Human   567 RIVGGAVSSEGEWPWQASL---QVRGRHICGGALIADRWVITAAHCFQEDSMASTVLWTVFLG-K 627

  Fly   182 EIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQLPKR-HYEYRS 245
            ..:|::..|:|...|  ....::|.........|:|:::|.|.|..:..:.|:.||.| |:    
Human   628 VWQNSRWPGEVSFKV--SRLLLHPYHEEDSHDYDVALLQLDHPVVRSAAVRPVCLPARSHF---- 686

  Fly   246 FKNKL-AIASGWGRYATGV---------------------HAISNVLRYVQLQIIDGRTCKSNFP 288
            |:..| ...:|||....|.                     ..|||.|:.|.:|:|....|...:.
Human   687 FEPGLHCWITGWGALREGALRADAVALFYGWRNQGSETCCCPISNALQKVDVQLIPQDLCSEVYR 751

  Fly   289 LSYRGTNICTSGRNA-RSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDR-GYPAAFTKVA 351
            .......:|...|.. :..|.||||||||. :..|.:..|.|:.|:|  .||.| .|...:|::.
Human   752 YQVTPRMLCAGYRKGKKDACQGDSGGPLVC-KALSGRWFLAGLVSWG--LGCGRPNYFGVYTRIT 813

  Fly   352 SYLDWI 357
            ..:.||
Human   814 GVISWI 819

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 78/264 (30%)
Tryp_SPc 123..359 CDD:238113 79/265 (30%)
TMPRSS6NP_001275929.1 SEA 77..177 CDD:307516
CUB 326..440 CDD:238001
LDLa 450..480 CDD:238060
LDLa 486..516 CDD:238060
Ldl_recept_a 520..557 CDD:278486
Tryp_SPc 568..822 CDD:238113 79/265 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.