DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and Gzmd

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_034502.2 Gene:Gzmd / 14941 MGIID:109255 Length:252 Species:Mus musculus


Alignment Length:258 Identity:80/258 - (31%)
Similarity:120/258 - (46%) Gaps:25/258 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 LMEKMLPEGAMAMDRIFGGDVGNPHCFPYQVGMLLQRPKG-LYWCGGSLISDKHVITAAHCVDMA 171
            |:..:||..|.| :.|.||.|..||..||...::....|| ..:|||.||.|..|:|||||.:.:
Mouse     7 LLTLLLPLRAGA-EEIIGGHVVKPHSRPYMAFVMSVDIKGNRIYCGGFLIQDDFVLTAAHCKNSS 70

  Fly   172 KRA--LVFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPI 234
            .::  .|.|||:.| .|||:.|  .::|......:|.:|......||.:::|.......:.:.|:
Mouse    71 VQSSMTVTLGAHNI-TAKEETQ--QIIPVAKDIPHPDYNATIFYSDIMLLKLESKAKRTKAVRPL 132

  Fly   235 QLPKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTNICTS 299
            :||:.:...:  ...:...:|||..:......|..||.|||.|.:...||..|......|.||..
Mouse   133 KLPRSNARVK--PGDVCSVAGWGSRSINDTKASARLREVQLVIQEDEECKKRFRYYTETTEICAG 195

  Fly   300 G-RNARSTCNGDSGGPLVLQRRHSKKRVLVGITSF---GSIYGCDRGYPAAFTKVASYLDWIS 358
            . :..::...||||||||...:      ..|:.::   |:|..      ..||||..:|.|||
Mouse   196 DLKKIKTPFKGDSGGPLVCDNQ------AYGLFAYAKNGTISS------GIFTKVVHFLPWIS 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 72/241 (30%)
Tryp_SPc 123..359 CDD:238113 75/243 (31%)
GzmdNP_034502.2 Tryp_SPc 20..245 CDD:214473 72/241 (30%)
Tryp_SPc 21..248 CDD:238113 75/243 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1076876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.