DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and CG43742

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:224 Identity:68/224 - (30%)
Similarity:98/224 - (43%) Gaps:39/224 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 YWCGGSLISDKHVITAAHCVDMAKRALVFLGANEIK------------NAKEKGQVRLMVPSENF 201
            ::||||||..::|:||||||.......|.||.|...            |||             .
  Fly    56 FFCGGSLIHKQYVLTAAHCVRDLDEVTVHLGENNRSCPIPVCKHVLRLNAK-------------V 107

  Fly   202 QIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQLPKRHYEYRSFKNKLAIASGWGRYATGVHAI 266
            .::|.::.....:|||::||...|.|...|.||.:........:.:|... |.|||:...|  .|
  Fly   108 ILHPNFHGNIFLNDIALLRLEREVIFEAHIRPICIILDEDVTSNNQNNFT-AYGWGKTEHG--NI 169

  Fly   267 SNVLRYVQLQIIDGRTCKSNFPLSYRGTNICTSGRNARSTCNGDSGGPLV--LQRRHSKKRVLVG 329
            |:||.::.|..:....|       |:..|...:|..:..||..||||||:  ...|...:.:|.|
  Fly   170 SDVLSFIDLVRLPKSMC-------YQNINTICAGSTSGDTCESDSGGPLIGNFVHRGKSRDILFG 227

  Fly   330 ITSFGSIYGCDRGYPAAFTKVASYLDWIS 358
            |||:|.. .|. |....:|.|.:|..||:
  Fly   228 ITSYGDA-ECS-GLFGVYTDVNAYKSWIA 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 66/221 (30%)
Tryp_SPc 123..359 CDD:238113 68/224 (30%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 66/221 (30%)
Tryp_SPc 35..256 CDD:238113 68/224 (30%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436441
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.