DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and CG43336

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:259 Identity:78/259 - (30%)
Similarity:118/259 - (45%) Gaps:41/259 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 AMDRIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCVDMAKRALVFLGANEI 183
            ::.|:..|.|.:....|:..  .|....|.:.||||||:::.|:|||||         ||...|:
  Fly    34 SVPRVKNGTVASLTSSPWMA--FLHSTDGRFICGGSLITNRLVLTAAHC---------FLDRTEL 87

  Fly   184 -----KNAKEKGQV--------RLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQ 235
                 :..:|:.::        |:....|....:..:||..:..||||:||...|.:.:.|.||.
  Fly    88 VARLGEYDREEYEMCHDSYCTYRIEAMVERGFRHRHYNPMTMAYDIAILRLYRKVQYTDNIRPIC 152

  Fly   236 L---PKRHYEYRSFKNKL--AIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTN 295
            :   |:    :|.:.:.|  ...:|||:  |.....|..||.|.|.......|:....||.....
  Fly   153 IVIDPR----WRKYIDSLDPLTGTGWGK--TESEGDSAKLRTVDLARKHPEVCRRYATLSLTANQ 211

  Fly   296 ICTSGRNARSTCNGDSGGPL--VLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLDWI 357
            .| :|....:.||||||||:  ::....||:.|.|||.||.:.. |  ...:.||.|.||:|||
  Fly   212 FC-AGNERSNLCNGDSGGPVGALIPYGKSKRFVQVGIASFTNTQ-C--VMVSVFTDVMSYVDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 76/254 (30%)
Tryp_SPc 123..359 CDD:238113 77/255 (30%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 76/254 (30%)
Tryp_SPc 40..271 CDD:238113 75/251 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436432
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.