DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and CG43110

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:268 Identity:75/268 - (27%)
Similarity:118/268 - (44%) Gaps:44/268 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 PEGAMAMDRIFGGDVGNPHCFPYQVGM-----LLQRPKGLYWCGGSLISDKHVITAAHCVDMAKR 173
            |.|...:.:|..|...:.....|..|:     ||        |||::|.:..|:|.||| ...:.
  Fly    27 PCGKTPVPKIISGSNASQQSAQYMAGIFNTTHLL--------CGGTIIHEDFVLTVAHC-KSTQT 82

  Fly   174 ALVFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPI---- 234
            ..|.|||..|.:..:  |:|::   |.. .:|.::.....:|||:|:|..:|.||..|.||    
  Fly    83 LFVRLGAYNINHPTD--QIRVI---ETI-AHPQYSNSTYANDIALVKLERSVIFNLNIQPICIHL 141

  Fly   235 --QLPKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTNIC 297
              .|.|:...|.:|        ||||......  |::|:.:.:...:...|.....:|.....||
  Fly   142 DATLGKQIRYYNAF--------GWGRTRNAEQ--SDILQRIFVNRTNPMICHLYLGMSPDPKQIC 196

  Fly   298 TSGRNARSTCNGDSGGPLVLQRRHSKKR--VLVGITSFGSIYGCDRGYPAAFTKVASYLDWISDE 360
            .: .:...||.|||||||:.:..:..|.  ...||||:|: ..|:.  ...:|.|:.|..||::.
  Fly   197 AT-TDQGDTCAGDSGGPLISKITYQGKNFDTQFGITSYGT-RECNG--VGLYTDVSQYSGWIANI 257

  Fly   361 TGVSAHQD 368
              |.:.||
  Fly   258 --VRSKQD 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 68/247 (28%)
Tryp_SPc 123..359 CDD:238113 70/248 (28%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 68/247 (28%)
Tryp_SPc 36..257 CDD:238113 70/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436445
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.