DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and CG43124

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:274 Identity:60/274 - (21%)
Similarity:100/274 - (36%) Gaps:74/274 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 MDRIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCVDMAKRALVFLGANEIK 184
            |:||.|....     |: :..:|...|.:  |.|:||::.:|:|||.|....::..|.||:....
  Fly    31 MERINGSSYA-----PW-LAEILSDSKVI--CAGALINNLYVLTAASCFKENEKLTVRLGSGYFD 87

  Fly   185 NAKEKGQVRLMVPSENFQI-----YPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQLPK------ 238
            .:           .|||::     :.|..|....:::.|.||...|.|...|.|:.:.|      
  Fly    88 KS-----------YENFRVTKAYFWMTHFPANNTNNLCIFRLQTEVEFKTHIRPMCITKSPKSLG 141

  Fly   239 --RHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTNICTSGR 301
              ..:|..:.|.|:     |       :...|         |.|..||..|            |.
  Fly   142 LATTFEIINEKPKM-----W-------YFCKN---------IKGLFCKYVF------------GE 173

  Fly   302 NARSTCNGDSGGPL--VLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLDWISDETGVS 364
            |.....:..:|.|.  .:.....|..|..||.|    |..::.|...:..|.|:::||:.   :|
  Fly   174 NEEKWQSKPTGSPWTETISNGPFKGLVRYGILS----YRDNKTYDEVYINVMSHINWIAQ---IS 231

  Fly   365 AHQDTTEAIFFDQY 378
            ...|.:..:...:|
  Fly   232 LEIDISTPVKKKEY 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 54/249 (22%)
Tryp_SPc 123..359 CDD:238113 55/250 (22%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 27/105 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.