DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and CG43125

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster


Alignment Length:109 Identity:29/109 - (26%)
Similarity:57/109 - (52%) Gaps:12/109 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 CGGSLISDKHVITAAHCVDMAKRALVFLGA--NEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLK 213
            |.|:||:::.|:|||.|:|.....:|.||.  ..::|:.:.....:.|  ....|:.:::.:..:
  Fly    52 CTGTLINERFVLTAASCIDYQTELIVRLGEIDGTLQNSSKLQYEEIYV--ARALIHRSYSSESHQ 114

  Fly   214 DDIAIVRLPHAVSFNERIHPI-------QLPKR-HYEYRSFKNK 249
            .:||::||..:|.:.:.|.||       ::||. .:|....||:
  Fly   115 YNIALLRLKTSVVYKKNIQPICIDVNVGKVPKAPTFEIEKKKNE 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 29/109 (27%)
Tryp_SPc 123..359 CDD:238113 29/109 (27%)
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 24/86 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436446
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.