DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and St14

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_446087.1 Gene:St14 / 114093 RGDID:69288 Length:855 Species:Rattus norvegicus


Alignment Length:269 Identity:72/269 - (26%)
Similarity:121/269 - (44%) Gaps:54/269 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 RIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHC------------------- 167
            |:.||...:...:|:||. |....:| :.||.||||...:::||||                   
  Rat   614 RVVGGTNADEGEWPWQVS-LHALGQG-HLCGASLISPDWLVSAAHCFQDETIFKYSDHTMWTAFL 676

  Fly   168 --VDMAKRALVFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNER 230
              :|.:||:     |:.::..|.|   |::.       :|::|......|||::.|.....::..
  Rat   677 GLLDQSKRS-----ASGVQEHKLK---RIIT-------HPSFNDFTFDYDIALLELEKPAEYSTV 726

  Fly   231 IHPIQLPKRHYEYRSFKNKLAIASGWGRYAT-GVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGT 294
            :.||.||...:.:.:  .|....:|||.... |..|:  :|:..::::|:..||:...|......
  Rat   727 VRPICLPDNTHVFPA--GKAIWVTGWGHTKEGGTGAL--ILQKGEIRVINQTTCEELLPQQITPR 787

  Fly   295 NICT---SGRNARSTCNGDSGGPLVLQRRHSKKRVL-VGITSFGSIYGC-DRGYPAAFTKVASYL 354
            .:|.   ||  ...:|.|||||||....:..  |:. .|:.|:|.  || .|..|..:|::....
  Rat   788 MMCVGFLSG--GVDSCQGDSGGPLSSVEKDG--RIFQAGVVSWGE--GCAQRNKPGVYTRIPEVR 846

  Fly   355 DWISDETGV 363
            |||.::|||
  Rat   847 DWIKEQTGV 855

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 67/261 (26%)
Tryp_SPc 123..359 CDD:238113 68/262 (26%)
St14NP_446087.1 SEA 88..178 CDD:396113
CUB 214..332 CDD:238001
CUB 340..444 CDD:238001
LDLa 454..486 CDD:238060
LDLa 492..523 CDD:238060
LDLa 525..559 CDD:238060
LDLa 567..602 CDD:238060
Tryp_SPc 615..852 CDD:238113 68/263 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.