DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and Ctrl

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_075671.1 Gene:Ctrl / 109660 MGIID:88558 Length:264 Species:Mus musculus


Alignment Length:241 Identity:76/241 - (31%)
Similarity:120/241 - (49%) Gaps:19/241 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 RIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCVDMAKRALVFLGANEIKNA 186
            ||..|:...|..:|:||.  ||...|.::|||||||...|:|||||.....|..|.||..:..:.
Mouse    33 RIVNGENAVPGSWPWQVS--LQDNTGFHFCGGSLISPNWVVTAAHCQVTPGRHFVVLGEYDRSSN 95

  Fly   187 KEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQLPKRHYEYRSFKNKLA 251
            .|..||..:..:..   :|.||...:.:|:.:::|.....:..::.|:.|...:....|  ....
Mouse    96 AEPVQVLSIARAIT---HPNWNANTMNNDLTLLKLASPARYTAQVSPVCLASTNEALPS--GLTC 155

  Fly   252 IASGWGRYATGVHAISNV----LRYVQLQIIDGRTCKSNFPLSYRGTNICTSGRNARSTCNGDSG 312
            :.:||||    :..:.||    |:.|.|.::....|:..:........||..|..| |:|.||||
Mouse   156 VTTGWGR----ISGVGNVTPARLQQVVLPLVTVNQCRQYWGARITDAMICAGGSGA-SSCQGDSG 215

  Fly   313 GPLVLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLDWIS 358
            ||||.|:.::  .||:||.|:|: ..|:...||.:|:|:.:..||:
Mouse   216 GPLVCQKGNT--WVLIGIVSWGT-KNCNIQAPAMYTRVSKFSTWIN 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 74/238 (31%)
Tryp_SPc 123..359 CDD:238113 75/240 (31%)
CtrlNP_075671.1 Tryp_SPc 33..257 CDD:214473 74/238 (31%)
Tryp_SPc 34..260 CDD:238113 75/240 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.