DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and LOC102553861

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001316820.1 Gene:LOC102553861 / 102553861 RGDID:7500593 Length:248 Species:Rattus norvegicus


Alignment Length:264 Identity:73/264 - (27%)
Similarity:122/264 - (46%) Gaps:29/264 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 LVLNLETTPLMEKMLPEGAMAMDRIFGGDVGNPHCFPYQVGMLLQRPKGL-YWCGGSLISDKHVI 162
            |:|.:...|..|..         .|.||...:||..||...:..:..... ..|||.||.:..|:
  Rat     6 LLLTVSLAPTTEAA---------EIIGGHEADPHSRPYMAYLQYKNEDSRDTICGGFLIREDFVL 61

  Fly   163 TAAHCVDMAKRALVFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSF 227
            |||||  ...:..|.|||:.||..::..||   :|......:|.:|.|.:.:||.:::|......
  Rat    62 TAAHC--SGSKINVTLGAHNIKEQEKTQQV---IPVVKIIPHPAYNAKTISNDIMLLKLKSKAKR 121

  Fly   228 NERIHPIQLPKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSY- 291
            ...:..:.||:.:::.:  ...:...:|||:... :....:.|:.|:|.:.:.:.|::....:| 
  Rat   122 TRAVKTLSLPRSNFKVK--PGDVCYVAGWGKLGP-MGKFPDKLQEVELTVQEDQECETYLKNAYD 183

  Fly   292 RGTNICTSGRNAR-STCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLD 355
            :...||......: ::..||||||||.      |:|..||.|:|.   .|...|.|||||:::|.
  Rat   184 KANQICAGDPKIKCASFQGDSGGPLVC------KKVAAGIVSYGR---KDGSTPRAFTKVSTFLS 239

  Fly   356 WISD 359
            ||.:
  Rat   240 WIEE 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 67/237 (28%)
Tryp_SPc 123..359 CDD:238113 69/238 (29%)
LOC102553861NP_001316820.1 Tryp_SPc 20..241 CDD:214473 67/237 (28%)
Tryp_SPc 21..244 CDD:238113 69/240 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1076876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.