DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and proc.2

DIOPT Version :10

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001120289.1 Gene:proc.2 / 100145345 XenbaseID:XB-GENE-5882297 Length:681 Species:Xenopus tropicalis


Alignment Length:128 Identity:28/128 - (21%)
Similarity:45/128 - (35%) Gaps:45/128 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 MPVSR--DPEALLAKYSDPLV--YTGFIRARTGNEILRLGAHLLQNLNRIKVPFLVMHGTADTVT 332
            |.|.|  |.:.||.:.:..||  .....:.:..|.:...|.|                    .:|
 Frog     1 MNVHRGSDSDRLLRQEASCLVDDTLAVAQEKEANSLASSGPH--------------------NLT 45

  Fly   333 DPKGTQKLYNEAS-----SSDKSIKLYDGLLHDLLF--------EPERETIAGVI-----LDW 377
            .|.|.:   ||.:     |:|.:.|.:|..|.:|:.        :.|||....|:     :||
 Frog    46 YPLGPR---NEGALLHELSNDGAHKQFDHYLEELILPIMVGCAKKGERECHIVVLTDEDSVDW 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 123..359 CDD:238113 20/95 (21%)
proc.2NP_001120289.1 GLA 19..80 CDD:214503 16/83 (19%)
EGF_CA 81..117 CDD:238011 6/25 (24%)
FXa_inhibition 123..160 CDD:464251
Tryp_SPc 436..666 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.