DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and hpn

DIOPT Version :10

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:XP_012811934.1 Gene:hpn / 100145343 XenbaseID:XB-GENE-995348 Length:417 Species:Xenopus tropicalis


Alignment Length:89 Identity:19/89 - (21%)
Similarity:34/89 - (38%) Gaps:11/89 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 QLSAAKKKIMPVSRDPEALLAKYSDPLVYTGFIRARTGNE--------ILRLGAHLLQNLNRIKV 319
            ||.....::....|...|::|.::. ..|.|...|....:        |..||......|:|..:
 Frog    27 QLEGWLSQVQSTKRPARAIIAPHAG-YTYCGSCAAHAYKQVDPSITRRIFILGPSHHVPLSRCAL 90

  Fly   320 PFLVMHGTADTVTDPKGTQKLYNE 343
            ..:.::.|  .:.|.:..||:|.|
 Frog    91 SSVDIYRT--PLYDLRIDQKIYGE 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 123..359 CDD:238113 19/89 (21%)
hpnXP_012811934.1 Hepsin-SRCR 50..159 CDD:462736 14/66 (21%)
Tryp_SPc 163..400 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.