DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and f7l

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001083027.2 Gene:f7l / 100038778 ZFINID:ZDB-GENE-070424-102 Length:431 Species:Danio rerio


Alignment Length:241 Identity:74/241 - (30%)
Similarity:122/241 - (50%) Gaps:15/241 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 RIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCVDMAKRALVFLGANEIKNA 186
            ||..|||......|:|.   |....|.|.|||.:::.:.:||||||:.....||:.:...|....
Zfish   194 RIVKGDVCPKGQCPWQA---LLEYDGQYKCGGVILNSQWIITAAHCIWRKDPALLQVIVGEHIRD 255

  Fly   187 KEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQLPKRHYEY-RSFKN-K 249
            :::|..::...||.| ::|.:|......|:|::||...|:......|:.||..:..: |:..: :
Zfish   256 RDEGTEQMRKVSEVF-LHPQYNHSSTDSDVALLRLHRPVTLGPYALPVCLPPPNGTFSRTLASIR 319

  Fly   250 LAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTNICTS-GRNARSTCNGDSGG 313
            ::..|||||.|.. ...|.||:.:|:..:....|::...|:.....:|.. ....|.:|.|||||
Zfish   320 MSTVSGWGRLAQS-GPPSTVLQRLQVPRVSSEDCRARSGLTVSRNMLCAGFAEGGRDSCQGDSGG 383

  Fly   314 PLVLQRRHSKKRVLVGITSFGSIYGCDRG--YPAAFTKVASYLDWI 357
            |||.:.|::  ..|.||.|:|.  ||.|.  | ..:|:|:.:::||
Zfish   384 PLVTRYRNT--WFLTGIVSWGK--GCARADVY-GIYTRVSVFVEWI 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 72/239 (30%)
Tryp_SPc 123..359 CDD:238113 73/240 (30%)
f7lNP_001083027.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.