DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and si:dkey-78l4.7

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:XP_003201098.1 Gene:si:dkey-78l4.7 / 100034654 ZFINID:ZDB-GENE-060503-176 Length:257 Species:Danio rerio


Alignment Length:246 Identity:79/246 - (32%)
Similarity:122/246 - (49%) Gaps:27/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 IFGGDVGNPHCFPYQVGMLLQRPKGL-YWCGGSLISDKHVITAAHCVDMAKRAL-VFLGANEIKN 185
            |..|....||..||.|.:    .||. :.|||.|||:|.|:||||| .|....| ..:||:.::|
Zfish    26 IVNGTEAKPHSRPYMVSL----QKGFQHVCGGFLISEKFVLTAAHC-RMGNEILTAVVGAHNLRN 85

  Fly   186 AKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQLPKRHYEYRSFKNKL 250
            ..|| .||:.|.|  :.::|.:..|..::|:.:::|...|..|:.:..|.:.|:.   |..|...
Zfish    86 RSEK-SVRMKVKS--YHLHPDFTVKPWRNDVMLLKLVKKVQLNKNVKIISMSKQE---RDIKPDS 144

  Fly   251 AIA-SGWGRYA-TGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTN-ICTSGRNARSTCNGDSG 312
            |.| :||.:.: .|  .:|..|....::|::...|::.:...|..:. ||..|..  .:|.||||
Zfish   145 ACAVAGWEKLSFKG--KVSTQLMEAGVKIMNNTECENKWKKIYLPSQMICVYGHG--GSCGGDSG 205

  Fly   313 GPLVLQRRHSKKRVLVGITSFGSIYGCD-RGYPAAFTKVASYLDWISDETG 362
            ||||.:      ...||:||||....|: |..|..:.|::.:|.||....|
Zfish   206 GPLVCE------DTAVGVTSFGDARVCNSRKRPEVYMKISEFLPWIDSIIG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 76/239 (32%)
Tryp_SPc 123..359 CDD:238113 78/241 (32%)
si:dkey-78l4.7XP_003201098.1 Tryp_SPc 26..248 CDD:238113 78/242 (32%)
Tryp_SPc 26..245 CDD:214473 76/239 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D434182at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.