DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and plaua

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:XP_017214157.1 Gene:plaua / 100008445 ZFINID:ZDB-GENE-090313-278 Length:421 Species:Danio rerio


Alignment Length:381 Identity:99/381 - (25%)
Similarity:157/381 - (41%) Gaps:94/381 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SMYPGPAGLSTSS--SSPFSSSGSLEHDAEMS-----ASNVD------------NRHIKGLGMGR 85
            |.|.|...::.|.  .:|::|.....:.|..:     ..|.|            ||::      |
Zfish    65 SKYTGKVSVTVSGRICAPWNSIQGSRYSAFKNCYHNYCRNPDDWTQPWCVVKKRNRYV------R 123

  Fly    86 EMSALSEEDDR--------EPLVLNLETTPLMEKMLPEGAMAMDR---IFGGDVGNPHCFPYQVG 139
            |...:.:|..:        ||:..:.|.|.        |...:||   |.||........|:...
Zfish   124 EYCNIPQEAIKPVKRPPTPEPIKQDTELTC--------GERRLDRQTKIIGGLRSTVESQPWMAA 180

  Fly   140 MLLQRPKG-LYWCGGSLISDKHVITAAHCVDMAKRA-----LVFLGANEIKNA----KEKGQVRL 194
            :.    || .:.|||:||:...|:|||||....||.     .|.||.|.|...    ::|..|..
Zfish   181 IF----KGDGFICGGTLITPCWVLTAAHCFPTGKRTQINRYSVVLGKNAINETDPVKEQKFTVSR 241

  Fly   195 MVPSENFQIYPTWNPKRLKDDIAIVRLPH-----AVSFNERIHPIQLPKRHYEYRSFKNKLAIA- 253
            :|..|:|. |.|.|   ...|||::::..     ||. .:.:....||       .|:..|.:. 
Zfish   242 LVIHEDFD-YSTEN---YTHDIALLKIEDCNGQCAVK-TKTVRTACLP-------PFQQMLPVGF 294

  Fly   254 ----SGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTNI-----CTSGRNARS-TCN 308
                :|:|||..|....|..|:..::::|..:.|:..:   |....:     |.:||:.:: .|.
Zfish   295 YCEIAGYGRYQKGTFKFSRYLKQTEVKLISQKVCQRTY---YNKDEVNENMLCANGRDWKTDACQ 356

  Fly   309 GDSGGPLVLQRRHSKKRVLVGITSFGSIYGC-DRGYPAAFTKVASYLDWISDETGV 363
            ||||||||.:..:.  ..|.||.|:|.  .| ::..|..:|:|::|..|||..||:
Zfish   357 GDSGGPLVCEVNNI--MFLFGIISWGK--ECAEKNQPGVYTQVSNYNQWISQHTGL 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 74/264 (28%)
Tryp_SPc 123..359 CDD:238113 75/262 (29%)
plauaXP_017214157.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.