DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6592 and gzm3.3

DIOPT Version :9

Sequence 1:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster
Sequence 2:NP_001108166.1 Gene:gzm3.3 / 100001138 ZFINID:ZDB-GENE-070912-135 Length:257 Species:Danio rerio


Alignment Length:255 Identity:75/255 - (29%)
Similarity:124/255 - (48%) Gaps:31/255 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 AMAMDR-IFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCVDMAKRAL----- 175
            |..||. |.||.|...|..||...:.:.:.   :.|||.||.|.:|:|||||::   |.:     
Zfish    15 AGGMDSGIIGGKVAKAHSRPYMASIQINKH---HTCGGMLIRDDYVLTAAHCLN---RGVYSGRG 73

  Fly   176 ---VFLGANEIKNAKEKGQVRLMVPSENFQIYPTWNPKRLKD---DIAIVRLPHAVSFNERIHPI 234
               |.|||:.| :..|:.|.|:.|  :.:..:|.:...:.||   ||.:::|.:....::.:..|
Zfish    74 HLEVVLGAHNI-SKHEQNQQRIQV--KKYIRHPMFQRNKEKDYSYDIMLLKLKNKAKISKFVKVI 135

  Fly   235 QLPKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTN-ICT 298
            .|||::.:..:  |.....:|||.........|:||..|.|::.....||:.:...:.... ||:
Zfish   136 SLPKKNGKIPA--NVKCSVAGWGLTKPKAELASDVLEEVTLKLQFDFECKTMWQQHFNTERMICS 198

  Fly   299 SGRNARSTCNGDSGGPLVLQRRHSKKRVLVGITSFGSIYGC-DRGYPAAFTKVASYLDWI 357
            ......:.|.|||||||:.   ::|.:.:|..|..|:   | ::.||..|.|::.:|.||
Zfish   199 VSDGKHAFCQGDSGGPLIC---NTKPQAIVSYTFEGN---CINKQYPQVFLKISYFLPWI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 70/248 (28%)
Tryp_SPc 123..359 CDD:238113 72/248 (29%)
gzm3.3NP_001108166.1 Tryp_SPc 22..255 CDD:238113 72/248 (29%)
Tryp_SPc 22..252 CDD:214473 70/246 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1076876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.