DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and si:dkey-238d18.3

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001373176.1 Gene:si:dkey-238d18.3 / 795978 ZFINID:ZDB-GENE-131127-38 Length:272 Species:Danio rerio


Alignment Length:276 Identity:69/276 - (25%)
Similarity:113/276 - (40%) Gaps:63/276 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LGVIASATAFEKPVFWKDVPVGKASIEGRITMGYPAYEGKVPYIVGLGFSKNGGGTWCGGSIIGN 73
            ||..|..:..:||:   |..:.:..::|...:.:|..         :....:.|...||||:|..
Zfish    23 LGWAAKESTTKKPI---DGDIHEGIMQGVDALRWPWQ---------VSIKTSSGEHLCGGSLINK 75

  Fly    74 TWVMTAKHCTDGMESVTIYYGALWRLQAQYTHWV--GRSD---------------FIEHG----- 116
            .||:||.||               ::||: :|:|  |:.|               .|.|.     
Zfish    76 FWVLTAAHC---------------QIQAR-SHYVVLGQHDRSSNDGTVQVKEIAKVITHPDNNIQ 124

  Fly   117 ---SGDISLIR-TPHVDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTSDEGGVSEYLNCVDV 177
               :.|::|:: :......|||:.|.|.....:.  ..|...:.:|||:|..|.. :..|....:
Zfish   125 TLFNNDVTLLKLSSPAQMTSLVSPVCLASSSSKI--VPGTLCVTTGWGRTKTELS-ARILQEATI 186

  Fly   178 QIGENSVCENYYGS--FSGDLICIPTPENKGTCSGDSGGPLVIHDGN--RQVGIVSFGSSAGCLS 238
            .|...|.|:..:|:  .:..:|| .......:|.|||||||:.....  .||||||:| :..|..
Zfish   187 PIVSQSQCKQIFGASKITNSMIC-AGGSGSSSCQGDSGGPLMCESSGVWYQVGIVSWG-NRDCRV 249

  Fly   239 NGPKGMVRVTSYLDWI 254
            :.|....||:.:..||
Zfish   250 DFPLVYARVSYFRKWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 60/246 (24%)
Tryp_SPc 41..257 CDD:238113 62/244 (25%)
si:dkey-238d18.3NP_001373176.1 Tryp_SPc 52..268 CDD:238113 62/244 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.