DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and Ctrc

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001029047.1 Gene:Ctrc / 76701 MGIID:1923951 Length:268 Species:Mus musculus


Alignment Length:298 Identity:80/298 - (26%)
Similarity:125/298 - (41%) Gaps:87/298 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLGVIASATAFEKPVFWKDVPVGKASIEGRITMGYPAYEGKVPYIVGLGFSKNGGGTW---CGG 68
            :|..::|.|::...|.|       ..::..|:..|..|.....|:.|.|.:.::  .||   |||
Mouse     6 VLAAILACASSCGDPTF-------PPNLSARVVGGEDAVPNSWPWQVSLQYLRD--DTWRHTCGG 61

  Fly    69 SIIGNTWVMTAKHCTD---------GMESVTI--YYGALW-RLQAQYTH--------WVGRSDFI 113
            |:|..:.|:||.||.:         |..::|:  ..|::: .:...|.|        |       
Mouse    62 SLITTSHVLTAAHCINTNLTYRVGLGKYNLTVEDEEGSVYAEVDTIYVHEKWNRLLLW------- 119

  Fly   114 EHGSGDISLIRTPH-VDFWSLVNKVELPRYDD----RYNNYQGWWALVSGWGKTSDEGGVSEYL- 172
                .||::|:... |:....:....:|..|.    .|..|      |:|||:....|.::|.| 
Mouse   120 ----NDIAIIKLAEPVELSDTIQVACIPEQDSLLPGDYPCY------VTGWGRLWTNGPIAEVLQ 174

  Fly   173 ----------NC--VD---VQIGENSVCENYYGSFSGDLICIPTPENKGTCSGDSGGPL--VIHD 220
                      .|  :|   :::.|..||....|..|             .|:|||||||  .:.|
Mouse   175 QGLQPIVNHTTCSRLDWWFIKVRETMVCAGGDGVIS-------------ACNGDSGGPLNCPVED 226

  Fly   221 GNRQV-GIVSFGSSAGCLS-NGPKGMVRVTSYLDWIRD 256
            |..|| ||||||||.||.: ..|....||::|:|||::
Mouse   227 GLWQVHGIVSFGSSRGCNTYKKPVVFTRVSAYIDWIKE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 73/264 (28%)
Tryp_SPc 41..257 CDD:238113 74/264 (28%)
CtrcNP_001029047.1 Tryp_SPc 29..262 CDD:214473 73/264 (28%)
Tryp_SPc 30..265 CDD:238113 74/267 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.