DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and Prss22

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_006524968.4 Gene:Prss22 / 70835 MGIID:1918085 Length:365 Species:Mus musculus


Alignment Length:284 Identity:80/284 - (28%)
Similarity:127/284 - (44%) Gaps:46/284 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVLLLGVIASATAFEKPVFWKDVPV----GKASIEGRITMGYPAYEGKVPYIVGLGFSKNGGGTW 65
            ::|:|.|:.::||   |:....:.|    ||.....||..|..:.:.:.|:||.:  .|| |...
Mouse    74 SILILLVLLTSTA---PISAATIRVSPDCGKPQQLNRIVGGEDSMDAQWPWIVSI--LKN-GSHH 132

  Fly    66 CGGSIIGNTWVMTAKHC----TDGMESVTIYYGALWRL-------QAQYTHWV---GRSDFIEHG 116
            |.||::.|.||:||.||    .|.....::..|| |:|       |.....||   .|..:.|..
Mouse   133 CAGSLLTNRWVVTAAHCFKSNMDKPSLFSVLLGA-WKLGSPGPRSQKVGIAWVLPHPRYSWKEGT 196

  Fly   117 SGDISLIRTPH-VDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTSDEGGV----SEYLNCVD 176
            ..||:|:|..| :.|...:..:.||....|.......|  ::|||...|  ||    .:.|..:.
Mouse   197 HADIALVRLEHSIQFSERILPICLPDSSVRLPPKTDCW--IAGWGSIQD--GVPLPHPQTLQKLK 257

  Fly   177 VQIGENSVCENYYGSFSGD------LICIPTPE-NKGTCSGDSGGPLV--IHDGNRQVGIVSFGS 232
            |.|.::.:|::.|...:|.      ::|....| .:..|.|||||||:  :.|.....||:|:|.
Mouse   258 VPIIDSELCKSLYWRGAGQEAITEGMLCAGYLEGERDACLGDSGGPLMCQVDDHWLLTGIISWGE 322

  Fly   233 SAGCLS-NGPKGMVRVTSYLDWIR 255
              ||.. |.|.....:.::..|::
Mouse   323 --GCAERNRPGVYTSLLAHRSWVQ 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 70/245 (29%)
Tryp_SPc 41..257 CDD:238113 69/244 (28%)
Prss22XP_006524968.4 Tryp_SPc 108..346 CDD:238113 70/247 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.