DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and cela2a

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_017945752.1 Gene:cela2a / 594883 XenbaseID:XB-GENE-970278 Length:269 Species:Xenopus tropicalis


Alignment Length:271 Identity:79/271 - (29%)
Similarity:108/271 - (39%) Gaps:69/271 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IEGRITMGYPAYEGKVPYIVGLGFSKNGG------------------GTW---CGGSIIGNTWVM 77
            :.|....|.|.|:..|..:|      ||.                  |.|   ||||:|.:.||:
 Frog    11 LAGAYCCGVPTYQPVVSRVV------NGEDVAPHSWPWQVSLQYLYYGYWYHTCGGSLISSNWVL 69

  Fly    78 TAKHCTDGMESVTIYYGALWRLQAQYTH----WVGRSDFIEH--------GSG-DISLIRTPH-V 128
            ||.||   :.|...|...|.:...:|..    .:..|..|.|        |:| |||||:... |
 Frog    70 TAAHC---ISSYNTYRVQLGKHNLRYIEPGQKIINVSKLINHPRWDPNSLGNGFDISLIKLEESV 131

  Fly   129 DFWSLVNKVELPR----YDDRYNNYQGWWALVSGWGKTSDEGGVSEYLNCVDVQIGENSVCENYY 189
            ||...|....||.    ...:|..|      |:|||.....|...:.|....:.:.:.:.|..: 
 Frog   132 DFSDTVQPACLPPAGYILPHQYGCY------VTGWGNIRTGGPEPDILQQGLLLVVDYATCSQW- 189

  Fly   190 GSFSGD-----LICIPTPENKGTCSGDSGGPLVIHDGN---RQVGIVSFGSSAGCLSNGPKG--- 243
             .:.||     :||........:|:|||||||...:.|   ...|:|||||:|||  |.||.   
 Frog   190 -DWWGDGVRTNMICAGGDGITSSCNGDSGGPLNCRNANGTWEVHGVVSFGSAAGC--NYPKKPSV 251

  Fly   244 MVRVTSYLDWI 254
            ..||:.:..||
 Frog   252 FSRVSEFNSWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 76/266 (29%)
Tryp_SPc 41..257 CDD:238113 78/264 (30%)
cela2aXP_017945752.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.