DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and cela1.1

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001020645.2 Gene:cela1.1 / 553249 ZFINID:ZDB-GENE-050522-187 Length:282 Species:Danio rerio


Alignment Length:281 Identity:75/281 - (26%)
Similarity:127/281 - (45%) Gaps:48/281 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VLAVLLLGVIASATAFEKPVFWKDVPVGKASIEGRITMGYPAYEGKVPYIVGLGFSKNGG-GTWC 66
            :|.:|||.|:| |....:|.:.:|:     :||.|:..|..|.....|:.:.|.:...|. ..:|
Zfish     1 MLRILLLSVLA-AIGLTEPRYLEDL-----AIEERVIGGEIAKPHSWPWQISLQYQSGGRYHHYC 59

  Fly    67 GGSIIGNTWVMTAKHCTD---------GMESVTIYYGALWRLQAQ----YTHWVGRSDFIEHGSG 118
            ||::|...|||.|.||.|         |....|.:.|....:..:    :.:|  ..:.:.:|: 
Zfish    60 GGTLIRPGWVMVAAHCVDTSRIWSVALGDHDTTTHEGPEQYISVKGVFIHPNW--NPNIVANGN- 121

  Fly   119 DISLIR-TPHVDFWSLVNKVELPRYDD--RYNNYQGWWALVSGWGKTSDEGGVSEYLNCVDVQIG 180
            ||:|:: :.:....|.|....||.|.:  .|    |....::|||:|...|.:|..|....:.:.
Zfish   122 DIALLQLSINATLSSYVQVATLPSYGEILPY----GHTCYITGWGRTQTGGSLSAQLKQAYMPVV 182

  Fly   181 ENSVC--ENYYGSFSGD-LICIPTPENKGTCSGDSGGPL--------VIHDGNRQVGIVSFGSSA 234
            ::..|  .:::||...| :||.....:...|.||||.||        |:|      |:.||.:|:
Zfish   183 DHETCSQSDWWGSTVKDRMICAGGTTSMSACHGDSGSPLNCLFNGEYVVH------GVTSFVASS 241

  Fly   235 GCLS-NGPKGMVRVTSYLDWI 254
            ||.: ..|....||:.::.|:
Zfish   242 GCNTYKKPTVFTRVSYHVSWL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 63/245 (26%)
Tryp_SPc 41..257 CDD:238113 63/243 (26%)
cela1.1NP_001020645.2 Tryp_SPc 29..261 CDD:214473 63/244 (26%)
Tryp_SPc 30..265 CDD:238113 63/246 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.