DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and ctrb.3

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001017724.1 Gene:ctrb.3 / 550419 ZFINID:ZDB-GENE-050417-229 Length:265 Species:Danio rerio


Alignment Length:276 Identity:81/276 - (29%)
Similarity:113/276 - (40%) Gaps:56/276 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IASATAFEKPVFWKDVPVGKASIEG--RITMGYPAYEGKVPYIVGL----GFSKNGGGTWCGGSI 70
            :.|..||....:...||.....:.|  ||..|..|.....|:.|.|    ||.      :||||:
Zfish     6 LLSCVAFFSAAYGCGVPAIPPVVSGYARIVNGEEAVPHSWPWQVSLQDFTGFH------FCGGSL 64

  Fly    71 IGNTWVMTAKHC-----------------TDGMESVTIYYGALWRLQAQYTHWVGRSDFIEHGSG 118
            |...||:||.||                 ::..|.:     ...::...:||....|:.||:   
Zfish    65 INEFWVVTAAHCSVRTSHRVILGEHNKGKSNTQEDI-----QTMKVSKVFTHPQYNSNTIEN--- 121

  Fly   119 DISLIR-TPHVDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGK-------TSDEGGVSEYLNCV 175
            ||:|:: |......:.|:.|.|....|.:.:  |...:.||||.       |.||      |..|
Zfish   122 DIALVKLTAPASLNAHVSPVCLAEASDNFAS--GMTCVTSGWGVTRYNALFTPDE------LQQV 178

  Fly   176 DVQIGENSVCENYYGSFSGDLICIPTPENKGTCSGDSGGPLVIHDGN--RQVGIVSFGSSAGCLS 238
            .:.:..|..|:|::||...|.:.........:|.||||||||....|  ..|||||:|||. |..
Zfish   179 ALPLLSNEDCKNHWGSNIRDTMICAGAAGASSCMGDSGGPLVCQKDNIWTLVGIVSWGSSR-CDP 242

  Fly   239 NGPKGMVRVTSYLDWI 254
            ..|....|||...||:
Zfish   243 TMPGVYGRVTELRDWV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 74/247 (30%)
Tryp_SPc 41..257 CDD:238113 73/245 (30%)
ctrb.3NP_001017724.1 Tryp_SPc 33..258 CDD:214473 74/247 (30%)
Tryp_SPc 34..261 CDD:238113 74/248 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.