DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and prss27

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_031749235.1 Gene:prss27 / 496619 XenbaseID:XB-GENE-5744470 Length:724 Species:Xenopus tropicalis


Alignment Length:288 Identity:90/288 - (31%)
Similarity:122/288 - (42%) Gaps:61/288 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLGVIASATAFEKPVFWKDVPVGKASIEGRITMGYPAYEGKVPYIVGLGFSKNGGGTWCGGSIIG 72
            |||:...||....|:           :..||..|..|.||:.|:.|..   :|.||.:|||::|.
 Frog    15 LLGITPGATDCGIPL-----------VSSRIMGGQSAQEGQWPWQVSF---RNNGGHFCGGTLIS 65

  Fly    73 NTWVMTAKHC---TDGMESVTIYYGALW-------------RLQAQYTHWVGRSDFIEHGSGDIS 121
            ..:|::|.||   :....|||...||..             :....|..:|...|     |||||
 Frog    66 KQYVISAAHCFPSSSSASSVTAVLGAYMIDQPDGNQVAIPVQSATNYPSYVNEGD-----SGDIS 125

  Fly   122 LIR--TPHVDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGK-TSDEGGVSEY-LNCVDVQIGEN 182
            |::  :| |.|.:.:..|.||.  |......|....|:|||. .||...||.. |..|.|.:.:.
 Frog   126 LVQLASP-VTFTNYILPVCLPA--DTVTFPTGLQCWVTGWGNIASDVSLVSPMTLQEVAVPLIDA 187

  Fly   183 SVCE------NYYGSFS----GDLICIP-TPENKGTCSGDSGGPLVIHDGNR--QVGIVSFGSSA 234
            :.|.      |.||:.|    .|:||.. ....|.:|.||||||||.....:  ..|:||||...
 Frog   188 NECNALYQTPNSYGTSSISVHSDMICAGFINGGKDSCQGDSGGPLVCSSSGQWFLAGVVSFGEGC 252

  Fly   235 GCLSNGPKGMVRVTSYLDWIRDNTGISY 262
            | .:..|.....:.||.|||     :||
 Frog   253 G-QAYRPGVYTLMPSYTDWI-----VSY 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 80/249 (32%)
Tryp_SPc 41..257 CDD:238113 80/248 (32%)
prss27XP_031749235.1 Tryp_SPc 34..271 CDD:238113 79/248 (32%)
Tryp_SPc 420..659 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.