Sequence 1: | NP_001286951.1 | Gene: | Jon65Ai / 38685 | FlyBaseID: | FBgn0035667 | Length: | 262 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001004582.1 | Gene: | ctrl / 447843 | ZFINID: | ZDB-GENE-040912-147 | Length: | 261 | Species: | Danio rerio |
Alignment Length: | 268 | Identity: | 78/268 - (29%) |
---|---|---|---|
Similarity: | 104/268 - (38%) | Gaps: | 72/268 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 VPVGKASIEG--RITMGYPAYEGKVPYIVGLGFSKNGGGTWCGGSIIGNTWVMTAKHCTDGMESV 89
Fly 90 TIYYGALWRLQAQYTHWV--GRSDFIEHGSGDISLIRTPHVDFWSLVNKVELPRYDDR-YNN--- 148
Fly 149 --------------------------YQGWWALVSGWGKTSDEGGVS--EYLNCVDVQIGENSVC 185
Fly 186 ENYYGS--FSGDLICIPTPENKGTCSGDSGGPLVIHDGNR--QVGIVSFGSSAGCLSNGPKGMVR 246
Fly 247 VTSYLDWI 254 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Jon65Ai | NP_001286951.1 | Tryp_SPc | 37..254 | CDD:214473 | 71/254 (28%) |
Tryp_SPc | 41..257 | CDD:238113 | 71/252 (28%) | ||
ctrl | NP_001004582.1 | Tryp_SPc | 31..254 | CDD:214473 | 71/254 (28%) |
Tryp_SPc | 32..257 | CDD:238113 | 72/255 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1522379at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |