DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and ctrl

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001004582.1 Gene:ctrl / 447843 ZFINID:ZDB-GENE-040912-147 Length:261 Species:Danio rerio


Alignment Length:268 Identity:78/268 - (29%)
Similarity:104/268 - (38%) Gaps:72/268 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VPVGKASIEG--RITMGYPAYEGKVPYIVGLGFSKNGGGTWCGGSIIGNTWVMTAKHCTDGMESV 89
            ||..|..|.|  ||..|..|..|..|:.|.|  .::.|..:||||:|...||:||.||       
Zfish    19 VPAIKPVISGYNRIVNGENAVSGSWPWQVSL--QQSNGFHFCGGSLINQYWVVTAAHC------- 74

  Fly    90 TIYYGALWRLQAQYTHWV--GRSDFIEHGSGDISLIRTPHVDFWSLVNKVELPRYDDR-YNN--- 148
                    |:||.| |:|  |     ||..|.    ....|...|:...:..|.|:.: :||   
Zfish    75 --------RVQAGY-HYVILG-----EHDRGS----SAESVQVKSIAKAITHPYYNSQNFNNDIT 121

  Fly   149 --------------------------YQGWWALVSGWGKTSDEGGVS--EYLNCVDVQIGENSVC 185
                                      ..|...:.:|||||   |..|  ..|....:.:...:.|
Zfish   122 LLKLSSPAQLTSRISPVCLAASSTSIPSGTRCVTTGWGKT---GSTSSPRILQQTALPLLSPAQC 183

  Fly   186 ENYYGS--FSGDLICIPTPENKGTCSGDSGGPLVIHDGNR--QVGIVSFGSSAGCLSNGPKGMVR 246
            :.|:|.  .:..:||... ....:|.||||||||......  ||||||:|:| .|....|....|
Zfish   184 KQYWGQNRITDAMICAGA-SGVSSCQGDSGGPLVCESSGAWYQVGIVSWGTS-DCNVRTPAVYAR 246

  Fly   247 VTSYLDWI 254
            |:....||
Zfish   247 VSYLRQWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 71/254 (28%)
Tryp_SPc 41..257 CDD:238113 71/252 (28%)
ctrlNP_001004582.1 Tryp_SPc 31..254 CDD:214473 71/254 (28%)
Tryp_SPc 32..257 CDD:238113 72/255 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.