DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and CTRB2

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001020371.3 Gene:CTRB2 / 440387 HGNCID:2522 Length:263 Species:Homo sapiens


Alignment Length:276 Identity:77/276 - (27%)
Similarity:105/276 - (38%) Gaps:56/276 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IASATAFEKPVFWKDVPVGKASIEG--RITMGYPAYEGKVPYIVGLGFSKNGGGTWCGGSIIGNT 74
            :.|..|.....|...||.....:.|  ||..|..|..|..|:.|.|  ....|..:||||:|...
Human     6 LLSCWALLGTTFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSL--QDKTGFHFCGGSLISED 68

  Fly    75 WVMTAKHCTDGMESVTIYYGALWRLQAQYTHWVGRSDFIEHGS---------------------- 117
            ||:||.||......|.:               .|..|   .||                      
Human    69 WVVTAAHCGVRTSDVVV---------------AGEFD---QGSDEENIQVLKIAKVFKNPKFSIL 115

  Fly   118 ---GDISLIR--TPHVDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTS-DEGGVSEYLNCVD 176
               .||:|::  || ..|...|:.|.||..||.:.  .|.....:|||||. :.....:.|....
Human   116 TVNNDITLLKLATP-ARFSQTVSAVCLPSADDDFP--AGTLCATTGWGKTKYNANKTPDKLQQAA 177

  Fly   177 VQIGENSVCENYYGSFSGDLICIPTPENKGTCSGDSGGPLVIH-DGN-RQVGIVSFGSSAGCLSN 239
            :.:..|:.|:..:|....|::.........:|.||||||||.. ||. ..|||||:||.. |.:.
Human   178 LPLLSNAECKKSWGRRITDVMICAGASGVSSCMGDSGGPLVCQKDGAWTLVGIVSWGSRT-CSTT 241

  Fly   240 GPKGMVRVTSYLDWIR 255
            .|....||...:.|::
Human   242 TPAVYARVAKLIPWVQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 70/246 (28%)
Tryp_SPc 41..257 CDD:238113 69/245 (28%)
CTRB2NP_001020371.3 Tryp_SPc 33..256 CDD:214473 70/246 (28%)
Tryp_SPc 34..259 CDD:238113 70/248 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.