DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and CG9737

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:290 Identity:70/290 - (24%)
Similarity:108/290 - (37%) Gaps:91/290 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GKASIEGRITMGYPAYEGKVPYIVGLGFSKNGGGTWCGGSIIGNTWVMTAKHCTDGM-------- 86
            || .:..||..|..|...:.|::..|.::.|..|  |.|::|.:..::||.||..|.        
  Fly   143 GK-QVTNRIYGGEIAELDEFPWLALLVYNSNDYG--CSGALIDDRHILTAAHCVQGEGVRDRQGL 204

  Fly    87 ---------------------------ESVTIYYGALWRLQAQYTHWVGRSDFIEHGSGDISLIR 124
                                       .::.|.|..: .:..:|      .:|..:...||::||
  Fly   205 KHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKI-HVHPEY------KEFSNYKYNDIAIIR 262

  Fly   125 TPH-VDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKT-----------------------SDE 165
            ..| |.|...|..:.||...:.....:|....|||||:|                       |:|
  Fly   263 LKHPVSFTHFVMPICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIPYVSNE 327

  Fly   166 GGVSEYLNCVDVQIGENSVCENYYGSFSGDLICIPTPENKGTCSGDSGGPLVIHDGNRQ------ 224
             ..::.|....|::|...:|..  |.|:           |.||:|||||||:..|  ||      
  Fly   328 -NCTKILEGFGVRLGPKQICAG--GEFA-----------KDTCAGDSGGPLMYFD--RQHSRWVA 376

  Fly   225 VGIVSFGSSAGCLSNGPKGMVRVTSYLDWI 254
            .|:||:|.:...::..|.....|..|.|||
  Fly   377 YGVVSYGFTQCGMAGKPAVYTNVAEYTDWI 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 66/281 (23%)
Tryp_SPc 41..257 CDD:238113 66/279 (24%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 66/281 (23%)
Tryp_SPc 150..409 CDD:238113 67/282 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.