DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and Jon99Cii

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster


Alignment Length:269 Identity:167/269 - (62%)
Similarity:184/269 - (68%) Gaps:11/269 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVLAVLLLGVIASATAFEKPVFWKDVPVGKASIEGRITMGYPAYEGKVPYIVGLGFSKNGGGTW 65
            ||:...|.|.| |:|||...|. .|..|.....|:||||.|||||||||||||||.||.| |..|
  Fly     1 MKLFVFLALAV-AAATAVPAPA-QKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGN-GNWW 62

  Fly    66 CGGSIIGNTWVMTAKHCTDGMESVTIYYGALWRLQAQYTHWVGRSDFIEH---GSG----DISLI 123
            |||||||||||:||.|||:|...|||.|||..|.|.|||||||..|.|:|   .||    |||||
  Fly    63 CGGSIIGNTWVLTAAHCTNGASGVTINYGASIRTQPQYTHWVGSGDIIQHHHYNSGNLHNDISLI 127

  Fly   124 RTPHVDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTSDEGGVSEYLNCVDVQIGENSVCENY 188
            |||||||||||||||||.|:|||.:|.||||:.||||.|.|...:.::|..|||||...|.|...
  Fly   128 RTPHVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSDCSRT 192

  Fly   189 YGSFSGDLICIPTPENKGTCSGDSGGPLVIHDGNRQVGIVSFGSSAGCLSNGPKGMVRVTSYLDW 253
            : |...::|||.|...|.||.||||||||.|||||.||:.||||:|||.|..|....|||.||||
  Fly   193 W-SLHDNMICINTDGGKSTCGGDSGGPLVTHDGNRLVGVTSFGSAAGCQSGAPAVFSRVTGYLDW 256

  Fly   254 IRDNTGISY 262
            |||||||||
  Fly   257 IRDNTGISY 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 143/223 (64%)
Tryp_SPc 41..257 CDD:238113 143/222 (64%)
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 145/225 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470761
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 192 1.000 Inparanoid score I6301
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - mtm9580
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
109.890

Return to query results.
Submit another query.