DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and CG11843

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:324 Identity:82/324 - (25%)
Similarity:122/324 - (37%) Gaps:116/324 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LGVIASATAFEKPVFWKDVPVG----KASIEGR-----------ITMGYPAYEGKVPYIVGLGF- 57
            :.|:.|.:.::|.||.:.:..|    .||||.|           |..|:||...:.|::..||. 
  Fly    24 MDVVGSCSRYKKSVFEERIEFGFLLPGASIESRIIDNCRSYTPLIVGGHPAQPREFPHMARLGRR 88

  Fly    58 -SKNGGGTW-CGGSIIGNTWVMTAKHCTDGMESVTIYYGALWRLQAQYTHWVGRSDFIEHGSGDI 120
             ..:....| |||.:|...:|:||.||                              :|...|::
  Fly    89 PDPSSRADWFCGGVLISERFVLTAAHC------------------------------LESERGEV 123

  Fly   121 SLIRTPHVDFWS-------------------------------LVNKVE------------LPRY 142
            :::|...:||.|                               ||...|            ||..
  Fly   124 NVVRLGELDFDSLDEDAAPRDYMVAGYIAHPGYEDPQFYHDIGLVKLTEAVVFDLYKHPACLPFQ 188

  Fly   143 DDRYNNYQGWWALVSGWGKTSDEGGVSEYLNCVDVQIGENSVC--------ENYYGSFSG-DLIC 198
            |:|.::.    .:..|||.|......|..|..|.:|...|.||        |.:...|.| :.:|
  Fly   189 DERSSDS----FIAVGWGSTGLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEFPRGFDGNNQLC 249

  Fly   199 IPTPENKGTCSGDSGGPLVIHDGNRQ-------VGIVSFGSSAGCLSNGPKGM-VRVTSYLDWI 254
            :.:...:.||:|||||||:::  :|:       |||.|.|.|.|  |.|..|: .||..||.||
  Fly   250 VGSEMAQDTCNGDSGGPLLMY--HREYPCMYVVVGITSAGLSCG--SPGIPGIYTRVYPYLGWI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 70/290 (24%)
Tryp_SPc 41..257 CDD:238113 70/277 (25%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 71/280 (25%)
Tryp_SPc 68..309 CDD:214473 69/278 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437097
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.