DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and CG11842

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:311 Identity:82/311 - (26%)
Similarity:120/311 - (38%) Gaps:71/311 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVLLLGVIA-----------SATAFEKPVFWKDVPVGKASIEGR----------------ITMGY 42
            ||||:..:|           :.||:::.| |::.......||..                |..|.
  Fly    14 AVLLVSFVAWASAQDSDIARTCTAYKRSV-WEETSEFSFLIENAPIIYKTLDKCTSYAPLIIGGG 77

  Fly    43 PAYEGKVPYIVGLGF-SKNGGGTW-CGGSIIGNTWVMTAKHCTDGME-SVTIYYGALWRLQAQYT 104
            ||...:.|:...||. .:||...| |||::|.:..|:||.||....: ||.|  ..|..|:....
  Fly    78 PAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHCHYSPQGSVNI--ARLGDLEFDTN 140

  Fly   105 H------WVGRSDFIEHGS-------GDISLIRTPH-VDFWSLVNKVELPRYDDRYNNYQGWWAL 155
            :      .....||..|..       .|||::|... |.|....:...||..|.|.    |...:
  Fly   141 NDDADPEDFDVKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACLPFDDGRL----GTSFI 201

  Fly   156 VSGWG----------KTSDEGGVSEYLNCVDVQIGENSVCENYYGSFSGDLICIPTPENKGTCSG 210
            ..|||          |...:..:..|.....:....|......|.:.:  .:||.:.|:|.||:|
  Fly   202 AIGWGQLEIVPRTENKKLQKVKLYNYGTRCRITADRNDELPEGYNATT--QLCIGSNEHKDTCNG 264

  Fly   211 DSGGPLVIHDGN-----RQVGIVSFGSSAGC-LSNGPKGMVRVTSYLDWIR 255
            |||||::|:..:     ..:||.|.|  ..| ..:.|....||..|||||:
  Fly   265 DSGGPVLIYHMDYPCMYHVMGITSIG--VACDTPDLPAMYTRVHFYLDWIK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 69/265 (26%)
Tryp_SPc 41..257 CDD:238113 70/248 (28%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 71/251 (28%)
Tryp_SPc 73..312 CDD:214473 69/248 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437095
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.030

Return to query results.
Submit another query.