DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Ai and CG4815

DIOPT Version :9

Sequence 1:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:231 Identity:51/231 - (22%)
Similarity:84/231 - (36%) Gaps:65/231 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 YPAYEGKVPYIVGLGFSK-NGGGTWCGGSIIGNTWVMTAKHCTDGMESVTIYYGALWRLQAQYTH 105
            |...:..|..:.|:|... ||....|..:::....::||.||.:             .|.....|
  Fly    36 YNGIKTTVESLGGVGIQLFNGRKLVCSATLLTPRHILTAAHCFE-------------NLNRSKFH 87

  Fly   106 WVG--RSDFIEHGS----------------------GDISL------IRTPHVDFWSLVNKVELP 140
            .:|  .::|..||:                      .|:::      :|:.::.:..|...|..|
  Fly    88 VIGGKSAEFTWHGNNFNKNKLIRVQIHPKYAKMKFIADVAVAKTKYPLRSKYIGYAQLCRSVLHP 152

  Fly   141 RYDDRYNNYQGWWALVSGWGKTSDEGGV-----SEYLNCVDVQIGENSVCENYYG-SFSGDLICI 199
            |  |:        .:.:|||   .||||     .:....:.|.|.....||.... ....::||.
  Fly   153 R--DK--------LIAAGWG---FEGGVWDESRKKTFRSMKVGIVSKRDCEKQLDRKMPPNIICA 204

  Fly   200 PTPENKGTCSGDSGGPLVIHDGNRQVGIVSFGSSAG 235
            ....||..|.|||||||::  |.:..||.::....|
  Fly   205 GAYNNKTLCFGDSGGPLLL--GRQVCGINTWTFKCG 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 51/231 (22%)
Tryp_SPc 41..257 CDD:238113 51/231 (22%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 48/218 (22%)
Trypsin 49..256 CDD:278516 48/218 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471123
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.